BLASTX nr result
ID: Akebia25_contig00023749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00023749 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlise... 123 2e-26 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 77 2e-12 >gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlisea aurea] Length = 84 Score = 123 bits (309), Expect = 2e-26 Identities = 58/62 (93%), Positives = 58/62 (93%) Frame = +3 Query: 3 PSTRGLGWANLWCTGCYANSSAGQLSWYGRTAAPREILLYTSSRTRFLNRT*IGERCKHR 182 PSTRGLGWANLW TGCYANSSAG LSWYGRTAA REILLYTSSRTRFLNRT IGERCKHR Sbjct: 23 PSTRGLGWANLWSTGCYANSSAGLLSWYGRTAAQREILLYTSSRTRFLNRTSIGERCKHR 82 Query: 183 EV 188 EV Sbjct: 83 EV 84 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 213 FRLVRDRFTPRGAYTSRLSKFCSKTSYENLYREGFP 106 FRLVRDRFTPRGAYTSRLSKFCSKTS+ENLYREGFP Sbjct: 359 FRLVRDRFTPRGAYTSRLSKFCSKTSFENLYREGFP 394