BLASTX nr result
ID: Akebia25_contig00023716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00023716 (208 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007042196.1| Uncharacterized protein TCM_006891 [Theobrom... 55 8e-06 >ref|XP_007042196.1| Uncharacterized protein TCM_006891 [Theobroma cacao] gi|508706131|gb|EOX98027.1| Uncharacterized protein TCM_006891 [Theobroma cacao] Length = 196 Score = 55.5 bits (132), Expect = 8e-06 Identities = 36/54 (66%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 44 EMASLCRSAGMAGARSLASIRPKTLISKTLNASSMPSLF-PPSTRSAPFASRIL 202 EMAS CRSA MAG+RSLAS R KTL K+L M S F PSTRS P ASRIL Sbjct: 101 EMASFCRSAVMAGSRSLAS-RSKTLTLKSLTPKPMSSPFSSPSTRSFPCASRIL 153