BLASTX nr result
ID: Akebia25_contig00023657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00023657 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006833314.1| hypothetical protein AMTR_s00109p00055760 [A... 73 4e-11 ref|XP_002309559.1| hypothetical protein POPTR_0006s25860g [Popu... 73 4e-11 emb|CAN72066.1| hypothetical protein VITISV_042589 [Vitis vinifera] 73 4e-11 ref|XP_003568728.1| PREDICTED: coiled-coil domain-containing pro... 72 8e-11 gb|EYU21884.1| hypothetical protein MIMGU_mgv1a013625mg [Mimulus... 71 2e-10 gb|EXC22695.1| hypothetical protein L484_001798 [Morus notabilis] 71 2e-10 ref|XP_006450631.1| hypothetical protein CICLE_v10009455mg [Citr... 71 2e-10 ref|XP_002324816.2| hypothetical protein POPTR_0018s00730g [Popu... 71 2e-10 ref|XP_006371716.1| hypothetical protein POPTR_0018s00730g [Popu... 71 2e-10 gb|EPS65986.1| hypothetical protein M569_08789 [Genlisea aurea] 71 2e-10 ref|XP_002284173.1| PREDICTED: coiled-coil domain-containing pro... 71 2e-10 ref|XP_007137181.1| hypothetical protein PHAVU_009G106500g [Phas... 70 3e-10 ref|XP_004960640.1| PREDICTED: coiled-coil domain-containing pro... 70 4e-10 ref|XP_007012057.1| Uncharacterized protein TCM_037150 [Theobrom... 70 4e-10 gb|AFW82085.1| hypothetical protein ZEAMMB73_801243 [Zea mays] 70 4e-10 gb|AFW82084.1| hypothetical protein ZEAMMB73_801243 [Zea mays] 70 4e-10 gb|ACN33512.1| unknown [Zea mays] gi|413949434|gb|AFW82083.1| hy... 70 4e-10 ref|NP_001150110.1| LOC100283739 [Zea mays] gi|194707814|gb|ACF8... 70 4e-10 ref|XP_006577835.1| PREDICTED: uncharacterized protein LOC100802... 69 5e-10 ref|XP_006366209.1| PREDICTED: coiled-coil domain-containing pro... 69 5e-10 >ref|XP_006833314.1| hypothetical protein AMTR_s00109p00055760 [Amborella trichopoda] gi|548837990|gb|ERM98592.1| hypothetical protein AMTR_s00109p00055760 [Amborella trichopoda] Length = 215 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDKHENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKHENEELIKYGFP 34 >ref|XP_002309559.1| hypothetical protein POPTR_0006s25860g [Populus trichocarpa] gi|222855535|gb|EEE93082.1| hypothetical protein POPTR_0006s25860g [Populus trichocarpa] Length = 215 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDKHENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKHENEELIKYGFP 34 >emb|CAN72066.1| hypothetical protein VITISV_042589 [Vitis vinifera] Length = 199 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDKHENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKHENEELIKYGFP 34 >ref|XP_003568728.1| PREDICTED: coiled-coil domain-containing protein 25-like [Brachypodium distachyon] Length = 215 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDKHENE+LIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKHENEDLIKYGFP 34 >gb|EYU21884.1| hypothetical protein MIMGU_mgv1a013625mg [Mimulus guttatus] Length = 215 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEELIKYGFP 34 >gb|EXC22695.1| hypothetical protein L484_001798 [Morus notabilis] Length = 215 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEELIKYGFP 34 >ref|XP_006450631.1| hypothetical protein CICLE_v10009455mg [Citrus clementina] gi|568844433|ref|XP_006476093.1| PREDICTED: coiled-coil domain-containing protein 25-like [Citrus sinensis] gi|557553857|gb|ESR63871.1| hypothetical protein CICLE_v10009455mg [Citrus clementina] Length = 215 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEELIKYGFP 34 >ref|XP_002324816.2| hypothetical protein POPTR_0018s00730g [Populus trichocarpa] gi|550317740|gb|EEF03381.2| hypothetical protein POPTR_0018s00730g [Populus trichocarpa] Length = 177 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEELIKYGFP 34 >ref|XP_006371716.1| hypothetical protein POPTR_0018s00730g [Populus trichocarpa] gi|550317739|gb|ERP49513.1| hypothetical protein POPTR_0018s00730g [Populus trichocarpa] Length = 153 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEELIKYGFP 34 >gb|EPS65986.1| hypothetical protein M569_08789 [Genlisea aurea] Length = 199 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEELIKYGFP 34 >ref|XP_002284173.1| PREDICTED: coiled-coil domain-containing protein 25-like [Vitis vinifera] Length = 215 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE DYTIFMGLDKHENEELIKYGFP Sbjct: 1 MVFYFKARPEAADYTIFMGLDKHENEELIKYGFP 34 >ref|XP_007137181.1| hypothetical protein PHAVU_009G106500g [Phaseolus vulgaris] gi|561010268|gb|ESW09175.1| hypothetical protein PHAVU_009G106500g [Phaseolus vulgaris] Length = 215 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK ENEELIKYGFP Sbjct: 1 MVFYFKARPESGDYTIFMGLDKFENEELIKYGFP 34 >ref|XP_004960640.1| PREDICTED: coiled-coil domain-containing protein 25-like [Setaria italica] Length = 215 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENE+LIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEDLIKYGFP 34 >ref|XP_007012057.1| Uncharacterized protein TCM_037150 [Theobroma cacao] gi|508782420|gb|EOY29676.1| Uncharacterized protein TCM_037150 [Theobroma cacao] Length = 215 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENEELI+YGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEELIRYGFP 34 >gb|AFW82085.1| hypothetical protein ZEAMMB73_801243 [Zea mays] Length = 196 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENE+LIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEDLIKYGFP 34 >gb|AFW82084.1| hypothetical protein ZEAMMB73_801243 [Zea mays] Length = 180 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENE+LIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEDLIKYGFP 34 >gb|ACN33512.1| unknown [Zea mays] gi|413949434|gb|AFW82083.1| hypothetical protein ZEAMMB73_801243 [Zea mays] Length = 119 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENE+LIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEDLIKYGFP 34 >ref|NP_001150110.1| LOC100283739 [Zea mays] gi|194707814|gb|ACF87991.1| unknown [Zea mays] gi|195627538|gb|ACG35599.1| coiled-coil domain-containing protein 25 [Zea mays] gi|195636814|gb|ACG37875.1| coiled-coil domain-containing protein 25 [Zea mays] gi|413949437|gb|AFW82086.1| coiled-coil domain-containing protein 25 [Zea mays] Length = 215 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENE+LIKYGFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEDLIKYGFP 34 >ref|XP_006577835.1| PREDICTED: uncharacterized protein LOC100802228 isoform X1 [Glycine max] Length = 188 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GD+TIFMGLDK+ENEELIKYGFP Sbjct: 1 MVFYFKARPEAGDFTIFMGLDKYENEELIKYGFP 34 >ref|XP_006366209.1| PREDICTED: coiled-coil domain-containing protein 25-like [Solanum tuberosum] Length = 215 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 191 MVFYYKARPEEGDYTIFMGLDKHENEELIKYGFP 292 MVFY+KARPE GDYTIFMGLDK+ENEELIK+GFP Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKYENEELIKFGFP 34