BLASTX nr result
ID: Akebia25_contig00023424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00023424 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA56091.1| TPA: hypothetical protein ZEAMMB73_002867 [Zea m... 68 1e-09 tpg|DAA56090.1| TPA: hypothetical protein ZEAMMB73_002867 [Zea m... 68 1e-09 tpg|DAA36535.1| TPA: hypothetical protein ZEAMMB73_278731, parti... 67 2e-09 ref|XP_004241632.1| PREDICTED: 40S ribosomal protein S7-like iso... 66 4e-09 ref|XP_004241630.1| PREDICTED: 40S ribosomal protein S7-like iso... 66 4e-09 ref|XP_004235808.1| PREDICTED: 40S ribosomal protein S7-like [So... 66 4e-09 ref|NP_001275109.1| ribosomal protein S7-like protein [Solanum t... 66 4e-09 tpg|DAA36537.1| TPA: hypothetical protein ZEAMMB73_278731 [Zea m... 66 4e-09 tpg|DAA36536.1| TPA: hypothetical protein ZEAMMB73_278731 [Zea m... 66 4e-09 ref|XP_006353807.1| PREDICTED: 40S ribosomal protein S7-like [So... 66 6e-09 ref|XP_006853690.1| hypothetical protein AMTR_s00056p00135710 [A... 66 6e-09 ref|XP_006847231.1| hypothetical protein AMTR_s00017p00257730 [A... 66 6e-09 ref|XP_004984883.1| PREDICTED: 40S ribosomal protein S7-like [Se... 66 6e-09 ref|XP_002459905.1| hypothetical protein SORBIDRAFT_02g014260 [S... 66 6e-09 ref|NP_001131888.1| 40S ribosomal protein S7 isoform 1 [Zea mays... 66 6e-09 gb|ACF80497.1| unknown [Zea mays] 66 6e-09 gb|ABK22771.1| unknown [Picea sitchensis] gi|116784348|gb|ABK233... 65 7e-09 ref|XP_002278371.1| PREDICTED: 40S ribosomal protein S7 isoform ... 65 7e-09 gb|ACG35364.1| 40S ribosomal protein S7 [Zea mays] 65 1e-08 ref|NP_001142070.1| uncharacterized protein LOC100274227 [Zea ma... 65 1e-08 >tpg|DAA56091.1| TPA: hypothetical protein ZEAMMB73_002867 [Zea mays] Length = 399 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGKVSLAFYLSHIFH 210 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK + H F+ Sbjct: 94 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGKSQVCKNAYHAFY 137 >tpg|DAA56090.1| TPA: hypothetical protein ZEAMMB73_002867 [Zea mays] Length = 513 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGKVSLAFYLSHIFH 210 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK + H F+ Sbjct: 94 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGKSQVCKNAYHAFY 137 >tpg|DAA36535.1| TPA: hypothetical protein ZEAMMB73_278731, partial [Zea mays] Length = 48 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGKV 243 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGKV Sbjct: 9 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGKV 41 >ref|XP_004241632.1| PREDICTED: 40S ribosomal protein S7-like isoform 3 [Solanum lycopersicum] Length = 155 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 91 >ref|XP_004241630.1| PREDICTED: 40S ribosomal protein S7-like isoform 1 [Solanum lycopersicum] gi|460392051|ref|XP_004241631.1| PREDICTED: 40S ribosomal protein S7-like isoform 2 [Solanum lycopersicum] Length = 191 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 91 >ref|XP_004235808.1| PREDICTED: 40S ribosomal protein S7-like [Solanum lycopersicum] gi|565349218|ref|XP_006341594.1| PREDICTED: 40S ribosomal protein S7-like [Solanum tuberosum] Length = 191 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 91 >ref|NP_001275109.1| ribosomal protein S7-like protein [Solanum tuberosum] gi|565399723|ref|XP_006365396.1| PREDICTED: 40S ribosomal protein S7-1 isoform X2 [Solanum tuberosum] gi|565399725|ref|XP_006365397.1| PREDICTED: 40S ribosomal protein S7-1 isoform X3 [Solanum tuberosum] gi|76160947|gb|ABA40437.1| 40S ribosomal protein S7-like protein [Solanum tuberosum] gi|76573341|gb|ABA46775.1| unknown [Solanum tuberosum] gi|77999315|gb|ABB17004.1| ribosomal protein S7-like protein [Solanum tuberosum] gi|82623373|gb|ABB87101.1| 40S ribosomal protein S7-like protein-like [Solanum tuberosum] Length = 191 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 91 >tpg|DAA36537.1| TPA: hypothetical protein ZEAMMB73_278731 [Zea mays] Length = 109 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGKV 243 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK+ Sbjct: 50 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGKL 82 >tpg|DAA36536.1| TPA: hypothetical protein ZEAMMB73_278731 [Zea mays] Length = 109 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGKV 243 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK+ Sbjct: 50 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGKL 82 >ref|XP_006353807.1| PREDICTED: 40S ribosomal protein S7-like [Solanum tuberosum] Length = 190 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|XP_006853690.1| hypothetical protein AMTR_s00056p00135710 [Amborella trichopoda] gi|548857351|gb|ERN15157.1| hypothetical protein AMTR_s00056p00135710 [Amborella trichopoda] Length = 191 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|XP_006847231.1| hypothetical protein AMTR_s00017p00257730 [Amborella trichopoda] gi|548850260|gb|ERN08812.1| hypothetical protein AMTR_s00017p00257730 [Amborella trichopoda] Length = 192 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|XP_004984883.1| PREDICTED: 40S ribosomal protein S7-like [Setaria italica] Length = 192 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|XP_002459905.1| hypothetical protein SORBIDRAFT_02g014260 [Sorghum bicolor] gi|241923282|gb|EER96426.1| hypothetical protein SORBIDRAFT_02g014260 [Sorghum bicolor] Length = 92 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|NP_001131888.1| 40S ribosomal protein S7 isoform 1 [Zea mays] gi|195605060|gb|ACG24360.1| 40S ribosomal protein S7 [Zea mays] gi|195605668|gb|ACG24664.1| 40S ribosomal protein S7 [Zea mays] gi|414866347|tpg|DAA44904.1| TPA: 40S ribosomal protein S7 isoform 1 [Zea mays] gi|414866348|tpg|DAA44905.1| TPA: 40S ribosomal protein S7 isoform 2 [Zea mays] Length = 192 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGK 91 >gb|ACF80497.1| unknown [Zea mays] Length = 141 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 9 AVVIHVPYRLRKAFRKIHVRLVRELEKKFSGK 40 >gb|ABK22771.1| unknown [Picea sitchensis] gi|116784348|gb|ABK23310.1| unknown [Picea sitchensis] gi|116792554|gb|ABK26412.1| unknown [Picea sitchensis] gi|148907989|gb|ABR17114.1| unknown [Picea sitchensis] gi|224286326|gb|ACN40871.1| unknown [Picea sitchensis] Length = 192 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVV+HVPYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 60 AVVVHVPYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|XP_002278371.1| PREDICTED: 40S ribosomal protein S7 isoform 1 [Vitis vinifera] gi|147789484|emb|CAN71757.1| hypothetical protein VITISV_000603 [Vitis vinifera] gi|297734220|emb|CBI15467.3| unnamed protein product [Vitis vinifera] Length = 191 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIH+PYRLRKAFRK+HVRLVRELEKKFSGK Sbjct: 60 AVVIHIPYRLRKAFRKIHVRLVRELEKKFSGK 91 >gb|ACG35364.1| 40S ribosomal protein S7 [Zea mays] Length = 192 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVR+VRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKIHVRIVRELEKKFSGK 91 >ref|NP_001142070.1| uncharacterized protein LOC100274227 [Zea mays] gi|194706990|gb|ACF87579.1| unknown [Zea mays] gi|195607642|gb|ACG25651.1| 40S ribosomal protein S7 [Zea mays] gi|195635315|gb|ACG37126.1| 40S ribosomal protein S7 [Zea mays] gi|413956016|gb|AFW88665.1| 40S ribosomal protein S7 isoform 1 [Zea mays] gi|413956017|gb|AFW88666.1| 40S ribosomal protein S7 isoform 2 [Zea mays] Length = 192 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 341 AVVIHVPYRLRKAFRKVHVRLVRELEKKFSGK 246 AVVIHVPYRLRKAFRK+HVR+VRELEKKFSGK Sbjct: 60 AVVIHVPYRLRKAFRKIHVRIVRELEKKFSGK 91