BLASTX nr result
ID: Akebia25_contig00023133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00023133 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003847929.1| hypothetical protein MYCGRDRAFT_106345 [Zymo... 61 2e-07 gb|EME44529.1| hypothetical protein DOTSEDRAFT_72108 [Dothistrom... 56 5e-06 >ref|XP_003847929.1| hypothetical protein MYCGRDRAFT_106345 [Zymoseptoria tritici IPO323] gi|339467803|gb|EGP82905.1| hypothetical protein MYCGRDRAFT_106345 [Zymoseptoria tritici IPO323] Length = 163 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = +3 Query: 3 ACVIGAVSSASNPRDIKSICQSP---DNITKYLGQNCGSNQQIAMGYFSSVCSDAGV 164 ACVIGAV++ SNP DI ++C++ D+ITK NCG+ Q+ A YFS VC DAGV Sbjct: 26 ACVIGAVNTQSNPHDIAAVCKAQEVQDSITK----NCGNAQEAAQKYFSEVCKDAGV 78 >gb|EME44529.1| hypothetical protein DOTSEDRAFT_72108 [Dothistroma septosporum NZE10] Length = 167 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/54 (44%), Positives = 33/54 (61%) Frame = +3 Query: 3 ACVIGAVSSASNPRDIKSICQSPDNITKYLGQNCGSNQQIAMGYFSSVCSDAGV 164 ACVI AV+ +P D K++CQ+ D + Y+ CG N A Y++ VC DAGV Sbjct: 25 ACVIAAVNQVPDPADTKAVCQN-DKVASYISSKCGDNIDAANSYYADVCKDAGV 77