BLASTX nr result
ID: Akebia25_contig00023073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00023073 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509936.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002509936.1| conserved hypothetical protein [Ricinus communis] gi|223549835|gb|EEF51323.1| conserved hypothetical protein [Ricinus communis] Length = 182 Score = 55.8 bits (133), Expect = 6e-06 Identities = 38/77 (49%), Positives = 50/77 (64%), Gaps = 4/77 (5%) Frame = +1 Query: 94 TVFRSKPNSAMVYRVEDRSKDGF---FNHSSELPTISEVLEIGKDYEGVSLEFDSMVSRR 264 +VF+S+ NS ++R DR D + ++ S L TI EV EI D+ G S E +S+V RR Sbjct: 109 SVFKSRQNSTGLFRFRDRPGDEYCAVYDKSGALSTIPEVPEI--DFGGFSPEINSLV-RR 165 Query: 265 TASARFTATS-MGISCA 312 + S RFTATS MGISCA Sbjct: 166 SGSERFTATSVMGISCA 182