BLASTX nr result
ID: Akebia25_contig00023043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00023043 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON65207.1| hypothetical protein W97_04444 [Coniosporium apol... 74 3e-11 gb|EME77646.1| hypothetical protein MYCFIDRAFT_53904 [Pseudocerc... 67 2e-09 gb|EUC32568.1| hypothetical protein COCCADRAFT_98343 [Bipolaris ... 64 2e-08 gb|EMD68512.1| hypothetical protein COCSADRAFT_22946 [Bipolaris ... 64 2e-08 gb|EUC41838.1| hypothetical protein COCMIDRAFT_8508 [Bipolaris o... 64 3e-08 ref|XP_003299383.1| hypothetical protein PTT_10359 [Pyrenophora ... 62 8e-08 gb|EMD96705.1| hypothetical protein COCHEDRAFT_1123285 [Bipolari... 60 2e-07 ref|XP_003841587.1| hypothetical protein LEMA_P095170.1 [Leptosp... 60 2e-07 ref|XP_001936765.1| conserved hypothetical protein [Pyrenophora ... 60 3e-07 gb|EGD99469.1| hypothetical protein TESG_06902 [Trichophyton ton... 59 7e-07 gb|EOA89559.1| hypothetical protein SETTUDRAFT_167423 [Setosphae... 59 9e-07 gb|EKG10692.1| hypothetical protein MPH_12176 [Macrophomina phas... 59 9e-07 ref|XP_007584431.1| putative lea domain protein [Neofusicoccum p... 57 2e-06 gb|EMD00218.1| hypothetical protein BAUCODRAFT_83952, partial [B... 57 2e-06 ref|XP_003175099.1| hypothetical protein MGYG_02629 [Arthroderma... 57 2e-06 gb|EME40267.1| hypothetical protein DOTSEDRAFT_74914 [Dothistrom... 57 3e-06 ref|XP_003232724.1| hypothetical protein TERG_06715 [Trichophyto... 57 3e-06 ref|XP_003025197.1| LEA domain protein [Trichophyton verrucosum ... 57 3e-06 ref|XP_003010867.1| LEA domain protein [Arthroderma benhamiae CB... 57 3e-06 ref|XP_002479878.1| LEA domain protein [Talaromyces stipitatus A... 56 6e-06 >gb|EON65207.1| hypothetical protein W97_04444 [Coniosporium apollinis CBS 100218] Length = 155 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 4 RLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAES 138 RLFSTSVR+QKGP++ AKDA K VDRT+S+AAVKGIEKGE+ AE+ Sbjct: 11 RLFSTSVRFQKGPIEVAKDAAKAVDRTISDAAVKGIEKGEQAAEA 55 >gb|EME77646.1| hypothetical protein MYCFIDRAFT_53904 [Pseudocercospora fijiensis CIRAD86] Length = 91 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 4 RLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELA 132 RLFSTSVR QKGPV+AAKD +KTVD++VS VKGIEKGEE A Sbjct: 11 RLFSTSVRVQKGPVEAAKDGLKTVDKSVSQTIVKGIEKGEEAA 53 >gb|EUC32568.1| hypothetical protein COCCADRAFT_98343 [Bipolaris zeicola 26-R-13] gi|578484658|gb|EUN22175.1| hypothetical protein COCVIDRAFT_112021 [Bipolaris victoriae FI3] Length = 104 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAES 138 ARLFST+ +K PVDA KDA KT+D+T+S AAVKGIEKGEE+A + Sbjct: 10 ARLFSTTPVARKSPVDAIKDAAKTIDKTISGAAVKGIEKGEEVANA 55 >gb|EMD68512.1| hypothetical protein COCSADRAFT_22946 [Bipolaris sorokiniana ND90Pr] Length = 104 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAES 138 ARLFST+ +K PVDA KDA KT+D+T+S AAVKGIEKGEE+A + Sbjct: 10 ARLFSTTPIARKSPVDAIKDAAKTIDKTISGAAVKGIEKGEEVANA 55 >gb|EUC41838.1| hypothetical protein COCMIDRAFT_8508 [Bipolaris oryzae ATCC 44560] Length = 104 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +1 Query: 4 RLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAES 138 RLFST+ +KGPV+A KDA KT+D+T+S AAVKGIEKGEE+A + Sbjct: 11 RLFSTTPVARKGPVEAIKDAAKTIDKTISGAAVKGIEKGEEVANA 55 >ref|XP_003299383.1| hypothetical protein PTT_10359 [Pyrenophora teres f. teres 0-1] gi|311326966|gb|EFQ92519.1| hypothetical protein PTT_10359 [Pyrenophora teres f. teres 0-1] Length = 104 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAES 138 ARLFST+ +K PVD KDA K VD+T+S AAVKGIEKGE++AE+ Sbjct: 10 ARLFSTTPVARKSPVDVIKDAAKAVDKTISGAAVKGIEKGEQVAEA 55 >gb|EMD96705.1| hypothetical protein COCHEDRAFT_1123285 [Bipolaris maydis C5] gi|477586488|gb|ENI03572.1| hypothetical protein COCC4DRAFT_199091 [Bipolaris maydis ATCC 48331] Length = 104 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAES 138 ARLFST+ +K PVDA KDA K VD+ +S AAVKGIEKGEE+A + Sbjct: 10 ARLFSTTPVARKSPVDAIKDAAKVVDKKISGAAVKGIEKGEEVANA 55 >ref|XP_003841587.1| hypothetical protein LEMA_P095170.1 [Leptosphaeria maculans JN3] gi|312218162|emb|CBX98108.1| hypothetical protein LEMA_P095170.1 [Leptosphaeria maculans JN3] Length = 104 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELA 132 ARLFST+ +K PV+ KDA K VDRT+S AAVKGIEKGEE+A Sbjct: 10 ARLFSTTPVARKSPVETIKDAAKAVDRTISGAAVKGIEKGEEVA 53 >ref|XP_001936765.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983864|gb|EDU49352.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 104 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAE 135 ARLFST+ +K PV+ KDA K VD+T+S AAVKGIEKGE++AE Sbjct: 10 ARLFSTTPVARKSPVEVIKDAAKAVDKTISGAAVKGIEKGEQVAE 54 >gb|EGD99469.1| hypothetical protein TESG_06902 [Trichophyton tonsurans CBS 112818] gi|326477497|gb|EGE01507.1| hypothetical protein TEQG_00557 [Trichophyton equinum CBS 127.97] gi|607894755|gb|EZF33584.1| hypothetical protein H101_02845 [Trichophyton interdigitale H6] Length = 123 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +1 Query: 10 FSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGE 123 FSTS +YQKGP++A KD +K DR VS+AAVKGIEKGE Sbjct: 32 FSTSPQYQKGPIEATKDTLKAADRLVSDAAVKGIEKGE 69 >gb|EOA89559.1| hypothetical protein SETTUDRAFT_167423 [Setosphaeria turcica Et28A] Length = 104 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAES 138 ARLFST+ +K PV+ KDA K VD+T+S AAVKGIEKGE++A++ Sbjct: 10 ARLFSTTPVARKSPVEVIKDAAKKVDQTISGAAVKGIEKGEQVADA 55 >gb|EKG10692.1| hypothetical protein MPH_12176 [Macrophomina phaseolina MS6] Length = 107 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAE 135 ARLF+TS R+QK VD+ KD K VDRTVS+ VKGIEK E+ A+ Sbjct: 10 ARLFTTSARFQKSAVDSVKDTAKKVDRTVSDELVKGIEKSEQAAD 54 >ref|XP_007584431.1| putative lea domain protein [Neofusicoccum parvum UCRNP2] gi|485922805|gb|EOD48133.1| putative lea domain protein [Neofusicoccum parvum UCRNP2] Length = 107 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELA 132 ARLF+TS R QK VD+ KD K VDRTV++ VKGIEKGE+ A Sbjct: 10 ARLFTTSARVQKSTVDSVKDTAKKVDRTVADELVKGIEKGEQAA 53 >gb|EMD00218.1| hypothetical protein BAUCODRAFT_83952, partial [Baudoinia compniacensis UAMH 10762] Length = 103 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 1 ARLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELAE 135 ARLFSTSVR + +D AKDA+K+VD+TVS AV GIE E++AE Sbjct: 10 ARLFSTSVRARNSAIDQAKDALKSVDKTVSKGAVAGIEAAEQIAE 54 >ref|XP_003175099.1| hypothetical protein MGYG_02629 [Arthroderma gypseum CBS 118893] gi|311340414|gb|EFQ99616.1| hypothetical protein MGYG_02629 [Arthroderma gypseum CBS 118893] Length = 123 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 7 LFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGE 123 LFSTS +QKGP++A KD +K DR VS+AAVKGIEKGE Sbjct: 31 LFSTSPYHQKGPIEATKDTLKAADRLVSDAAVKGIEKGE 69 >gb|EME40267.1| hypothetical protein DOTSEDRAFT_74914 [Dothistroma septosporum NZE10] Length = 94 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/44 (68%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +1 Query: 4 RLFSTS-VRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEELA 132 RLFSTS V +KGP++ K+AVK VDRTVS+ VKGIEKGEE A Sbjct: 11 RLFSTSRVVLEKGPIEGTKEAVKQVDRTVSDTLVKGIEKGEEAA 54 >ref|XP_003232724.1| hypothetical protein TERG_06715 [Trichophyton rubrum CBS 118892] gi|326465035|gb|EGD90488.1| hypothetical protein TERG_06715 [Trichophyton rubrum CBS 118892] gi|607880947|gb|EZF25752.1| hypothetical protein H100_01944 [Trichophyton rubrum MR850] gi|607907818|gb|EZF44924.1| hypothetical protein H102_01943 [Trichophyton rubrum CBS 100081] gi|607919902|gb|EZF55577.1| hypothetical protein H103_01954 [Trichophyton rubrum CBS 288.86] gi|607931919|gb|EZF66157.1| hypothetical protein H104_01929 [Trichophyton rubrum CBS 289.86] gi|607943835|gb|EZF76777.1| hypothetical protein H105_01958 [Trichophyton soudanense CBS 452.61] gi|607955853|gb|EZF87373.1| hypothetical protein H110_01953 [Trichophyton rubrum MR1448] gi|607992062|gb|EZG19690.1| hypothetical protein H107_02012 [Trichophyton rubrum CBS 202.88] Length = 123 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 10 FSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGE 123 FSTS ++QKGP++A KD +K DR VS+AAVKGIEKGE Sbjct: 32 FSTSPQHQKGPIEATKDTLKAADRLVSDAAVKGIEKGE 69 >ref|XP_003025197.1| LEA domain protein [Trichophyton verrucosum HKI 0517] gi|291189290|gb|EFE44586.1| LEA domain protein [Trichophyton verrucosum HKI 0517] Length = 123 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 10 FSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGE 123 FSTS ++QKGP++A KD +K DR VS+AAVKGIEKGE Sbjct: 32 FSTSPQHQKGPIEATKDTLKAADRLVSDAAVKGIEKGE 69 >ref|XP_003010867.1| LEA domain protein [Arthroderma benhamiae CBS 112371] gi|291174412|gb|EFE30227.1| LEA domain protein [Arthroderma benhamiae CBS 112371] Length = 123 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 10 FSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGE 123 FSTS ++QKGP++A KD +K DR VS+AAVKGIEKGE Sbjct: 32 FSTSPQHQKGPIEATKDTLKAADRLVSDAAVKGIEKGE 69 >ref|XP_002479878.1| LEA domain protein [Talaromyces stipitatus ATCC 10500] gi|242781827|ref|XP_002479879.1| LEA domain protein [Talaromyces stipitatus ATCC 10500] gi|218720025|gb|EED19444.1| LEA domain protein [Talaromyces stipitatus ATCC 10500] gi|218720026|gb|EED19445.1| LEA domain protein [Talaromyces stipitatus ATCC 10500] Length = 112 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 4 RLFSTSVRYQKGPVDAAKDAVKTVDRTVSNAAVKGIEKGEEL 129 R FST++ Q+GPV+A KD +K DRTVS+AAVKGIE GE L Sbjct: 23 RSFSTTLATQRGPVEATKDVLKKADRTVSDAAVKGIETGETL 64