BLASTX nr result
ID: Akebia25_contig00022852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00022852 (566 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007580107.1| hypothetical protein UCRNP2_783 [Neofusicocc... 65 1e-08 gb|EKG16651.1| hypothetical protein MPH_06105 [Macrophomina phas... 62 1e-07 >ref|XP_007580107.1| hypothetical protein UCRNP2_783 [Neofusicoccum parvum UCRNP2] gi|485928827|gb|EOD52418.1| hypothetical protein UCRNP2_783 [Neofusicoccum parvum UCRNP2] Length = 634 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/45 (68%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = +3 Query: 72 HCQKMKKEAEKKPRPGKGAQRMREVGLELAAYRGKKAE--HMLSY 200 HC+K KE E++P PGKGA+RMREVG+ LAAYRGKKA H+LSY Sbjct: 590 HCRKACKEKERRPAPGKGAERMREVGMGLAAYRGKKATPVHVLSY 634 >gb|EKG16651.1| hypothetical protein MPH_06105 [Macrophomina phaseolina MS6] Length = 242 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = +3 Query: 72 HCQKMKKEAEKKPRPGKGAQRMREVGLELAAYRGKKAE--HMLSY 200 HC+K K+ E++P PGKGA+RMREVG+ LAA+RGKKA H+LSY Sbjct: 198 HCRKACKKEERRPAPGKGAERMREVGMGLAAWRGKKATPVHVLSY 242