BLASTX nr result
ID: Akebia25_contig00022811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00022811 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510330.1| ubiquitin-protein ligase, putative [Ricinus ... 55 1e-05 >ref|XP_002510330.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551031|gb|EEF52517.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 426 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 3/83 (3%) Frame = -2 Query: 254 RWRYLWTCIPILQF--KYPQSDLQNPTCVR-KFINFVDGFLLLHNMNVQKFYLVSNDEID 84 +WRY W IP L F K Q+ T ++ K +N +D LLLHN +QKF L D + Sbjct: 47 KWRYKWAKIPHLVFDNKCVSIPSQDQTLIKDKLVNIIDHVLLLHNGPIQKFKLSHRDLLG 106 Query: 83 ESIVNRWISCVVRHKVQELCLDM 15 S ++RWI + R ++E L++ Sbjct: 107 VSDIDRWILHLSRSSIKEFILEI 129