BLASTX nr result
ID: Akebia25_contig00022625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00022625 (492 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856052.1| hypothetical protein AMTR_s00059p00089270 [A... 58 1e-06 >ref|XP_006856052.1| hypothetical protein AMTR_s00059p00089270 [Amborella trichopoda] gi|548859911|gb|ERN17519.1| hypothetical protein AMTR_s00059p00089270 [Amborella trichopoda] Length = 395 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +2 Query: 11 YELNTEKKVKIFNILKRKPDVKN*YGWSLSLNGKDFHPLKGNNISIFMV 157 +E + KK K FN+ K++PD KN GW+L++ KDF PLKG N+ +FMV Sbjct: 220 HEERSNKKRKPFNVYKKEPDFKNPNGWTLTVTRKDFPPLKGTNVGVFMV 268