BLASTX nr result
ID: Akebia25_contig00022294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00022294 (1142 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027442.1| Transducin/WD40 repeat-like superfamily prot... 59 3e-06 >ref|XP_007027442.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508716047|gb|EOY07944.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 633 Score = 59.3 bits (142), Expect = 3e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -2 Query: 427 CMLDGSYFTQLKSLMQNDKLLVFDMRQTAKPMESMNGLTCQPVHTIHSL 281 C D + Q+ + +QN +LVFDMRQTA+ M+SMNGLT PVHTIHSL Sbjct: 393 CSWDLNRSHQIYAGLQNGSVLVFDMRQTARHMDSMNGLTSNPVHTIHSL 441