BLASTX nr result
ID: Akebia25_contig00022115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00022115 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|A5AEC8.1|ARGJ_VITVI RecName: Full=Arginine biosynthesis bifun... 58 2e-06 gb|EYU41693.1| hypothetical protein MIMGU_mgv1a009220mg [Mimulus... 57 2e-06 ref|XP_002274213.2| PREDICTED: arginine biosynthesis bifunctiona... 57 3e-06 >sp|A5AEC8.1|ARGJ_VITVI RecName: Full=Arginine biosynthesis bifunctional protein ArgJ, chloroplastic; Includes: RecName: Full=Glutamate N-acetyltransferase; Short=GAT; AltName: Full=Ornithine acetyltransferase; Short=OATase; AltName: Full=Ornithine transacetylase; Includes: RecName: Full=Amino-acid acetyltransferase; AltName: Full=N-acetylglutamate synthase; Short=AGS; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ alpha chain; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ beta chain; Flags: Precursor gi|147801761|emb|CAN77854.1| hypothetical protein VITISV_037692 [Vitis vinifera] Length = 510 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = -1 Query: 156 LCFEMLS*AAVSGRDPNWGRIACTAGYAGSPFHPNK 49 LCF AAV GRDPNWGRIAC AGYAG PF PNK Sbjct: 409 LCF-----AAVYGRDPNWGRIACAAGYAGIPFQPNK 439 >gb|EYU41693.1| hypothetical protein MIMGU_mgv1a009220mg [Mimulus guttatus] Length = 349 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 141 LS*AAVSGRDPNWGRIACTAGYAGSPFHPNK 49 L+ AAV GRDPNWGRIAC AGYAG PF+PNK Sbjct: 248 LTKAAVYGRDPNWGRIACAAGYAGIPFNPNK 278 >ref|XP_002274213.2| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Vitis vinifera] gi|297741477|emb|CBI32609.3| unnamed protein product [Vitis vinifera] Length = 470 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 141 LS*AAVSGRDPNWGRIACTAGYAGSPFHPNK 49 L+ AAV GRDPNWGRIAC AGYAG PF PNK Sbjct: 369 LAKAAVYGRDPNWGRIACAAGYAGIPFQPNK 399