BLASTX nr result
ID: Akebia25_contig00022035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00022035 (657 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276375.1| PREDICTED: uncharacterized protein LOC100256... 65 1e-08 >ref|XP_002276375.1| PREDICTED: uncharacterized protein LOC100256309 [Vitis vinifera] gi|297740274|emb|CBI30456.3| unnamed protein product [Vitis vinifera] Length = 410 Score = 65.5 bits (158), Expect = 1e-08 Identities = 35/62 (56%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = -2 Query: 656 NAAGQVMSEGAHFQTGHLEESGK--HSQFEEGRNKLMGMMTEVLSTQIARQAFAQAAKS* 483 +AAG+ MS G+ Q EES K H +FEEG+NKLMGMMT+V STQI +Q+F+ AK Sbjct: 348 DAAGRTMSRGSQVQMARFEESRKNDHLRFEEGKNKLMGMMTDVRSTQIGKQSFSVPAKVG 407 Query: 482 GL 477 GL Sbjct: 408 GL 409