BLASTX nr result
ID: Akebia25_contig00021892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00021892 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERF69608.1| hypothetical protein EPUS_01938 [Endocarpon pusil... 56 6e-06 gb|EUC45928.1| hypothetical protein COCMIDRAFT_4964 [Bipolaris o... 55 8e-06 ref|XP_001792695.1| hypothetical protein SNOG_02077 [Phaeosphaer... 55 1e-05 >gb|ERF69608.1| hypothetical protein EPUS_01938 [Endocarpon pusillum Z07020] Length = 739 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/54 (44%), Positives = 36/54 (66%) Frame = +1 Query: 187 PDAGAKSNMEVDYVVIFEYGTEDLANATKQFEKLTQALEGVGLDTSVRAGDDHT 348 P A A+SN+++DYV+++ + ED A F+ L +AL VGL+T VR G+D T Sbjct: 4 PSASAESNLDIDYVLVYRFSREDKNKAISNFQNLIRALADVGLETEVRNGEDST 57 >gb|EUC45928.1| hypothetical protein COCMIDRAFT_4964 [Bipolaris oryzae ATCC 44560] Length = 772 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/68 (42%), Positives = 40/68 (58%) Frame = +1 Query: 145 LLAANCSTMAPRIEPDAGAKSNMEVDYVVIFEYGTEDLANATKQFEKLTQALEGVGLDTS 324 L +A+ S MA ++N++VDYV+ + + D A AT QFEKL +AL GL T Sbjct: 35 LASASPSDMAK----STALQTNLDVDYVITYRFADTDKAKATAQFEKLCEALANAGLQTE 90 Query: 325 VRAGDDHT 348 VR GD H+ Sbjct: 91 VRNGDSHS 98 >ref|XP_001792695.1| hypothetical protein SNOG_02077 [Phaeosphaeria nodorum SN15] gi|160704416|gb|EAT90289.2| hypothetical protein SNOG_02077 [Phaeosphaeria nodorum SN15] Length = 1045 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = +1 Query: 202 KSNMEVDYVVIFEYGTEDLANATKQFEKLTQALEGVGLDTSVRAGDDHT 348 +SN++VDYV+ + + D A A QFEKL +AL VGL T VR GD H+ Sbjct: 330 QSNLDVDYVISYRFAKTDKAKAIAQFEKLCEALANVGLQTEVRNGDSHS 378