BLASTX nr result
ID: Akebia25_contig00021434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00021434 (498 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003857754.1| Ca2+/calmodulin-dependent protein kinase [Zy... 56 5e-06 >ref|XP_003857754.1| Ca2+/calmodulin-dependent protein kinase [Zymoseptoria tritici IPO323] gi|339477639|gb|EGP92730.1| Ca2+/calmodulin-dependent protein kinase [Zymoseptoria tritici IPO323] Length = 669 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 3/40 (7%) Frame = -1 Query: 498 RKQVKNK-GAFELSLDNATLLGRRGKKD--PSGLREQLVL 388 ++QV+NK GAFELSLDNATLLGRRGKKD PSGLR++ V+ Sbjct: 629 KRQVRNKAGAFELSLDNATLLGRRGKKDAGPSGLRQEQVV 668