BLASTX nr result
ID: Akebia25_contig00021425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00021425 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511360.1| transporter, putative [Ricinus communis] gi|... 56 5e-06 >ref|XP_002511360.1| transporter, putative [Ricinus communis] gi|223550475|gb|EEF51962.1| transporter, putative [Ricinus communis] Length = 260 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 245 KSYASLVRFCTADTVRKEYFTETTLPVDFKD 153 KSYAS+VRFC+ DTVRKEYFTE T+P DF+D Sbjct: 230 KSYASMVRFCSVDTVRKEYFTEETVPPDFRD 260