BLASTX nr result
ID: Akebia25_contig00021363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00021363 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006429972.1| hypothetical protein CICLE_v10011870mg [Citr... 77 2e-12 ref|XP_006429971.1| hypothetical protein CICLE_v10011870mg [Citr... 77 2e-12 gb|EXC03814.1| Uncharacterized protein L484_012427 [Morus notabi... 77 3e-12 ref|XP_002267146.2| PREDICTED: uncharacterized protein At3g58460... 76 4e-12 ref|XP_006481670.1| PREDICTED: uncharacterized protein At3g58460... 75 7e-12 ref|XP_006481669.1| PREDICTED: uncharacterized protein At3g58460... 75 7e-12 ref|XP_006481668.1| PREDICTED: uncharacterized protein At3g58460... 75 7e-12 ref|XP_004494298.1| PREDICTED: uncharacterized protein At3g58460... 75 7e-12 ref|XP_003521512.1| PREDICTED: uncharacterized protein At3g58460... 74 2e-11 ref|XP_002309277.1| rhomboid family protein [Populus trichocarpa... 74 3e-11 ref|XP_006604684.1| PREDICTED: uncharacterized protein At3g58460... 72 6e-11 ref|XP_007163028.1| hypothetical protein PHAVU_001G199900g [Phas... 70 2e-10 ref|XP_004303389.1| PREDICTED: uncharacterized protein At3g58460... 69 5e-10 ref|XP_003638088.1| hypothetical protein MTR_118s0012 [Medicago ... 69 7e-10 ref|XP_007203755.1| hypothetical protein PRUPE_ppa003734mg [Prun... 67 3e-09 ref|XP_002531598.1| Rhomboid protein, putative [Ricinus communis... 66 4e-09 gb|EYU38723.1| hypothetical protein MIMGU_mgv1a024171mg [Mimulus... 66 6e-09 ref|XP_006339191.1| PREDICTED: uncharacterized protein At3g58460... 65 1e-08 ref|XP_006291244.1| hypothetical protein CARUB_v10017375mg [Caps... 65 1e-08 ref|XP_002878222.1| rhomboid family protein [Arabidopsis lyrata ... 65 1e-08 >ref|XP_006429972.1| hypothetical protein CICLE_v10011870mg [Citrus clementina] gi|557532029|gb|ESR43212.1| hypothetical protein CICLE_v10011870mg [Citrus clementina] Length = 404 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 120 LLSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LLSTC+RRPKFILCTGGNPSGYIPT+S NT+SSGL SGN Sbjct: 230 LLSTCIRRPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGN 269 >ref|XP_006429971.1| hypothetical protein CICLE_v10011870mg [Citrus clementina] gi|557532028|gb|ESR43211.1| hypothetical protein CICLE_v10011870mg [Citrus clementina] Length = 408 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 120 LLSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LLSTC+RRPKFILCTGGNPSGYIPT+S NT+SSGL SGN Sbjct: 230 LLSTCIRRPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGN 269 >gb|EXC03814.1| Uncharacterized protein L484_012427 [Morus notabilis] Length = 446 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 L+ CVRRPKFILCTGGNPSGYIPTHSS +TTSSGL+SGN Sbjct: 231 LAPCVRRPKFILCTGGNPSGYIPTHSSQSTTSSGLLSGN 269 >ref|XP_002267146.2| PREDICTED: uncharacterized protein At3g58460-like [Vitis vinifera] gi|296089310|emb|CBI39082.3| unnamed protein product [Vitis vinifera] Length = 406 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 120 LLSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LLS+CVRRPKFILCTGGNP YIPTHSS+NT+ SGLISGN Sbjct: 230 LLSSCVRRPKFILCTGGNPQAYIPTHSSSNTSPSGLISGN 269 >ref|XP_006481670.1| PREDICTED: uncharacterized protein At3g58460-like isoform X3 [Citrus sinensis] Length = 325 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 120 LLSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LLSTC+R+PKFILCTGGNPSGYIPT+S NT+SSGL SGN Sbjct: 147 LLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGN 186 >ref|XP_006481669.1| PREDICTED: uncharacterized protein At3g58460-like isoform X2 [Citrus sinensis] Length = 404 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 120 LLSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LLSTC+R+PKFILCTGGNPSGYIPT+S NT+SSGL SGN Sbjct: 230 LLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGN 269 >ref|XP_006481668.1| PREDICTED: uncharacterized protein At3g58460-like isoform X1 [Citrus sinensis] Length = 408 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 120 LLSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LLSTC+R+PKFILCTGGNPSGYIPT+S NT+SSGL SGN Sbjct: 230 LLSTCIRQPKFILCTGGNPSGYIPTYSGQNTSSSGLFSGN 269 >ref|XP_004494298.1| PREDICTED: uncharacterized protein At3g58460-like [Cicer arietinum] Length = 416 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LS+CVRRPKFI+CTGGNPSGYIPTH+S N+T+SGL+SGN Sbjct: 237 LSSCVRRPKFIVCTGGNPSGYIPTHTSQNSTTSGLLSGN 275 >ref|XP_003521512.1| PREDICTED: uncharacterized protein At3g58460-like [Glycine max] Length = 414 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -3 Query: 114 STCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 S+CVRRPKFI+CTGGNPSGYIPTH+S N+T+SGL+SGN Sbjct: 238 SSCVRRPKFIVCTGGNPSGYIPTHTSQNSTTSGLLSGN 275 >ref|XP_002309277.1| rhomboid family protein [Populus trichocarpa] gi|222855253|gb|EEE92800.1| rhomboid family protein [Populus trichocarpa] Length = 410 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LS+CVRRPKFILCTGG+P+ YIPTHS NTTSSGL+SGN Sbjct: 231 LSSCVRRPKFILCTGGSPTSYIPTHSGQNTTSSGLLSGN 269 >ref|XP_006604684.1| PREDICTED: uncharacterized protein At3g58460-like [Glycine max] Length = 414 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LS+CVRRPKFI+CTGGNPSGYIPT +S N+T+SGL+SGN Sbjct: 237 LSSCVRRPKFIVCTGGNPSGYIPTQTSQNSTTSGLLSGN 275 >ref|XP_007163028.1| hypothetical protein PHAVU_001G199900g [Phaseolus vulgaris] gi|561036492|gb|ESW35022.1| hypothetical protein PHAVU_001G199900g [Phaseolus vulgaris] Length = 412 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LS+CVRRPKFI+CTGGNPSGYIPTH+S N+T SGL+SGN Sbjct: 237 LSSCVRRPKFIVCTGGNPSGYIPTHTSQNST-SGLLSGN 274 >ref|XP_004303389.1| PREDICTED: uncharacterized protein At3g58460-like [Fragaria vesca subsp. vesca] Length = 375 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 LLSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LLSTCVRRPKFILCTGGNPS IPT++S T SSGL SGN Sbjct: 230 LLSTCVRRPKFILCTGGNPSASIPTYTSQGTASSGLFSGN 269 >ref|XP_003638088.1| hypothetical protein MTR_118s0012 [Medicago truncatula] gi|355504023|gb|AES85226.1| hypothetical protein MTR_118s0012 [Medicago truncatula] Length = 403 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LS+CVRRPKFI+CTGGNPSGYIPT++S+ +T+SG+ SGN Sbjct: 231 LSSCVRRPKFIVCTGGNPSGYIPTNTSSYSTTSGIFSGN 269 >ref|XP_007203755.1| hypothetical protein PRUPE_ppa003734mg [Prunus persica] gi|462399286|gb|EMJ04954.1| hypothetical protein PRUPE_ppa003734mg [Prunus persica] Length = 552 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 LLSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LLSTCVRRPKFILCTGGNPS +IPT+SS T SSG +G+ Sbjct: 373 LLSTCVRRPKFILCTGGNPSAFIPTYSSQGTASSGFSAGS 412 >ref|XP_002531598.1| Rhomboid protein, putative [Ricinus communis] gi|223528794|gb|EEF30801.1| Rhomboid protein, putative [Ricinus communis] Length = 397 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LS+CVRRPKFI+CTGGNP+ YIPT+SS N + GL SGN Sbjct: 231 LSSCVRRPKFIMCTGGNPTAYIPTYSSQNMNTGGLFSGN 269 >gb|EYU38723.1| hypothetical protein MIMGU_mgv1a024171mg [Mimulus guttatus] Length = 489 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 LSTCVRRPK+I+C+G N SG+IPT++S +TTSSGL+SGN Sbjct: 231 LSTCVRRPKYIICSGSNTSGHIPTYTSQSTTSSGLLSGN 269 >ref|XP_006339191.1| PREDICTED: uncharacterized protein At3g58460-like [Solanum tuberosum] Length = 408 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/40 (72%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTS-SGLISGN 1 LSTCVRRPKFI+CTGGN +GY+PTHS+ TS SG++SGN Sbjct: 231 LSTCVRRPKFIMCTGGNGAGYLPTHSNQTVTSRSGVLSGN 270 >ref|XP_006291244.1| hypothetical protein CARUB_v10017375mg [Capsella rubella] gi|482559951|gb|EOA24142.1| hypothetical protein CARUB_v10017375mg [Capsella rubella] Length = 403 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 +S+ VRRPKFI+CTGGNPS YIPT+S+ NTTSSG +GN Sbjct: 231 MSSFVRRPKFIMCTGGNPSSYIPTYSAQNTTSSGFSTGN 269 >ref|XP_002878222.1| rhomboid family protein [Arabidopsis lyrata subsp. lyrata] gi|297324060|gb|EFH54481.1| rhomboid family protein [Arabidopsis lyrata subsp. lyrata] Length = 403 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 117 LSTCVRRPKFILCTGGNPSGYIPTHSSTNTTSSGLISGN 1 +S+ VRRPKFI+CTGGNPS YIPT+S+ NTTSSG +GN Sbjct: 231 MSSFVRRPKFIMCTGGNPSSYIPTYSAQNTTSSGFSTGN 269