BLASTX nr result
ID: Akebia25_contig00021362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00021362 (227 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001798550.1| hypothetical protein SNOG_08228 [Phaeosphaer... 88 1e-15 gb|EOA82526.1| hypothetical protein SETTUDRAFT_165037 [Setosphae... 84 2e-14 ref|XP_003300917.1| hypothetical protein PTT_12281 [Pyrenophora ... 84 2e-14 ref|XP_001938644.1| conserved hypothetical protein [Pyrenophora ... 84 2e-14 gb|EUN27475.1| hypothetical protein COCVIDRAFT_15613 [Bipolaris ... 84 3e-14 gb|EUC43931.1| hypothetical protein COCMIDRAFT_99576 [Bipolaris ... 84 3e-14 gb|EUC27858.1| hypothetical protein COCCADRAFT_41525 [Bipolaris ... 84 3e-14 gb|EON65287.1| hypothetical protein W97_04525 [Coniosporium apol... 84 3e-14 gb|EMD89388.1| hypothetical protein COCHEDRAFT_1180946 [Bipolari... 84 3e-14 gb|EMD61145.1| hypothetical protein COCSADRAFT_39839 [Bipolaris ... 84 3e-14 gb|EMF11460.1| cysteine proteinase [Sphaerulina musiva SO2202] 83 4e-14 gb|EME88688.1| hypothetical protein MYCFIDRAFT_96825, partial [P... 83 4e-14 gb|EMC92924.1| hypothetical protein BAUCODRAFT_114953 [Baudoinia... 83 4e-14 ref|XP_007586240.1| putative ubiquitin c-terminal protein [Neofu... 82 6e-14 gb|EME41887.1| hypothetical protein DOTSEDRAFT_74070 [Dothistrom... 82 8e-14 ref|XP_003834548.1| similar to ubiquitin carboxyl-terminal hydro... 82 8e-14 gb|EKG20246.1| Peptidase C19 ubiquitin carboxyl-terminal hydrola... 80 4e-13 gb|ETN47056.1| hypothetical protein HMPREF1541_01246 [Cyphelloph... 72 6e-11 sp|P0CAQ1.1|UBP16_EMENI RecName: Full=Ubiquitin carboxyl-termina... 72 6e-11 ref|XP_660477.1| hypothetical protein AN2873.2 [Aspergillus nidu... 72 6e-11 >ref|XP_001798550.1| hypothetical protein SNOG_08228 [Phaeosphaeria nodorum SN15] gi|160702019|gb|EAT84504.2| hypothetical protein SNOG_08228 [Phaeosphaeria nodorum SN15] Length = 500 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKPS+STFVTLTL+VPQ+ +TSLNACFDGML Sbjct: 242 FPFEGKIESQIECETCHFKPKPSVSTFVTLTLNVPQVS-STSLNACFDGML 291 >gb|EOA82526.1| hypothetical protein SETTUDRAFT_165037 [Setosphaeria turcica Et28A] Length = 616 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++STFVTLTL+VPQ +TSLNAC DGML Sbjct: 235 FPFEGKIESQIECQSCHFKPKPTVSTFVTLTLNVPQ-ASSTSLNACLDGML 284 >ref|XP_003300917.1| hypothetical protein PTT_12281 [Pyrenophora teres f. teres 0-1] gi|311324739|gb|EFQ90990.1| hypothetical protein PTT_12281 [Pyrenophora teres f. teres 0-1] Length = 616 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++STFVTLTL+VPQ +TSLNAC DGML Sbjct: 236 FPFEGKIESQIECQTCHFKPKPTVSTFVTLTLNVPQ-ASSTSLNACLDGML 285 >ref|XP_001938644.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985743|gb|EDU51231.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 619 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++STFVTLTL+VPQ +TSLNAC DGML Sbjct: 239 FPFEGKIESQIECQTCHFKPKPTVSTFVTLTLNVPQ-ASSTSLNACLDGML 288 >gb|EUN27475.1| hypothetical protein COCVIDRAFT_15613 [Bipolaris victoriae FI3] Length = 622 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++STFVTLTL+VPQ +TSLNAC DGML Sbjct: 239 FPFEGKIESQIECQVCHFKPKPTVSTFVTLTLNVPQ-ASSTSLNACLDGML 288 >gb|EUC43931.1| hypothetical protein COCMIDRAFT_99576 [Bipolaris oryzae ATCC 44560] Length = 621 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++STFVTLTL+VPQ +TSLNAC DGML Sbjct: 238 FPFEGKIESQIECQVCHFKPKPTVSTFVTLTLNVPQ-ASSTSLNACLDGML 287 >gb|EUC27858.1| hypothetical protein COCCADRAFT_41525 [Bipolaris zeicola 26-R-13] Length = 622 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++STFVTLTL+VPQ +TSLNAC DGML Sbjct: 239 FPFEGKIESQIECQVCHFKPKPTVSTFVTLTLNVPQ-ASSTSLNACLDGML 288 >gb|EON65287.1| hypothetical protein W97_04525 [Coniosporium apollinis CBS 100218] Length = 604 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++++QIEC CHFKPKP++STFVTLTL++PQ +TSLN+CFDGML Sbjct: 242 FPFEGKIQSQIECVTCHFKPKPTVSTFVTLTLNIPQQS-STSLNSCFDGML 291 >gb|EMD89388.1| hypothetical protein COCHEDRAFT_1180946 [Bipolaris maydis C5] gi|477581981|gb|ENH99096.1| hypothetical protein COCC4DRAFT_76752 [Bipolaris maydis ATCC 48331] Length = 622 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++STFVTLTL+VPQ +TSLNAC DGML Sbjct: 239 FPFEGKIESQIECQVCHFKPKPTVSTFVTLTLNVPQ-ASSTSLNACLDGML 288 >gb|EMD61145.1| hypothetical protein COCSADRAFT_39839 [Bipolaris sorokiniana ND90Pr] Length = 622 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++STFVTLTL+VPQ +TSLNAC DGML Sbjct: 239 FPFEGKIESQIECQVCHFKPKPTVSTFVTLTLNVPQ-ASSTSLNACLDGML 288 >gb|EMF11460.1| cysteine proteinase [Sphaerulina musiva SO2202] Length = 633 Score = 83.2 bits (204), Expect = 4e-14 Identities = 34/51 (66%), Positives = 45/51 (88%) Frame = -1 Query: 176 VFPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGM 24 +FP +G+LE+Q+EC+HCHFKPKPSISTF+TLTL+VP +T+L+ CFDGM Sbjct: 258 IFPLQGKLESQVECSHCHFKPKPSISTFLTLTLNVPHEQTSTTLSECFDGM 308 >gb|EME88688.1| hypothetical protein MYCFIDRAFT_96825, partial [Pseudocercospora fijiensis CIRAD86] Length = 629 Score = 83.2 bits (204), Expect = 4e-14 Identities = 33/52 (63%), Positives = 45/52 (86%) Frame = -1 Query: 176 VFPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 VFP +G+LE+Q+EC+HC FKPKP++S+F+TLTLHVP L + +LN CFDG+L Sbjct: 248 VFPLQGKLESQVECSHCRFKPKPTVSSFLTLTLHVPHLQTSATLNECFDGLL 299 >gb|EMC92924.1| hypothetical protein BAUCODRAFT_114953 [Baudoinia compniacensis UAMH 10762] Length = 630 Score = 83.2 bits (204), Expect = 4e-14 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FP EG++E+Q+EC+HC FKPKPS+S+FVTLTLHVP +TSLNAC DG+L Sbjct: 258 FPLEGKVESQVECSHCRFKPKPSVSSFVTLTLHVPYDRTSTSLNACLDGLL 308 >ref|XP_007586240.1| putative ubiquitin c-terminal protein [Neofusicoccum parvum UCRNP2] gi|485920185|gb|EOD46280.1| putative ubiquitin c-terminal protein [Neofusicoccum parvum UCRNP2] Length = 447 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG+LE+QIEC CHFKPKPS+S+FVTLTL+VP +TSLN CFDGML Sbjct: 238 FPFEGKLESQIECLTCHFKPKPSVSSFVTLTLNVPHQS-STSLNQCFDGML 287 >gb|EME41887.1| hypothetical protein DOTSEDRAFT_74070 [Dothistroma septosporum NZE10] Length = 640 Score = 82.0 bits (201), Expect = 8e-14 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = -1 Query: 176 VFPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 VFP EG+LE+Q+EC+HCHFKPKPS+ +F+TLTL VP +++LN CFDGML Sbjct: 263 VFPLEGKLESQVECSHCHFKPKPSVMSFLTLTLAVPHDSTSSTLNQCFDGML 314 >ref|XP_003834548.1| similar to ubiquitin carboxyl-terminal hydrolase [Leptosphaeria maculans JN3] gi|312211097|emb|CBX91183.1| similar to ubiquitin carboxyl-terminal hydrolase [Leptosphaeria maculans JN3] Length = 551 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG++E+QIEC CHFKPKP++S FVTLTL+VPQ +TSLN CFDGML Sbjct: 175 FPFEGKIESQIECLTCHFKPKPTVSDFVTLTLNVPQCS-STSLNECFDGML 224 >gb|EKG20246.1| Peptidase C19 ubiquitin carboxyl-terminal hydrolase 2 [Macrophomina phaseolina MS6] Length = 605 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG+LE+QIEC CHFKPKP++S+FVTLTL VP +TSLN CFDGML Sbjct: 235 FPFEGQLESQIECLTCHFKPKPAVSSFVTLTLAVPHQS-STSLNQCFDGML 284 >gb|ETN47056.1| hypothetical protein HMPREF1541_01246 [Cyphellophora europaea CBS 101466] Length = 584 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/53 (62%), Positives = 44/53 (83%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGMLNA 15 FPFEGR+E+QI+C HC FK KPS++TFV+LTL+VPQ +TSL+ CFD +L + Sbjct: 225 FPFEGRIESQIQCQHCGFKTKPSVTTFVSLTLNVPQKS-STSLDNCFDILLKS 276 >sp|P0CAQ1.1|UBP16_EMENI RecName: Full=Ubiquitin carboxyl-terminal hydrolase 16; AltName: Full=Deubiquitinating enzyme 16; AltName: Full=Ubiquitin thioesterase 16; AltName: Full=Ubiquitin-specific-processing protease 16 Length = 624 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG+LE+QIEC CH+K KP+ ++FV LTL VPQ +T+LNACFDG+L Sbjct: 235 FPFEGKLESQIECQFCHYKYKPNQTSFVNLTLQVPQRS-STTLNACFDGLL 284 >ref|XP_660477.1| hypothetical protein AN2873.2 [Aspergillus nidulans FGSC A4] gi|40744268|gb|EAA63444.1| hypothetical protein AN2873.2 [Aspergillus nidulans FGSC A4] Length = 1026 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -1 Query: 173 FPFEGRLEAQIECTHCHFKPKPSISTFVTLTLHVPQLGHATSLNACFDGML 21 FPFEG+LE+QIEC CH+K KP+ ++FV LTL VPQ +T+LNACFDG+L Sbjct: 637 FPFEGKLESQIECQFCHYKYKPNQTSFVNLTLQVPQRS-STTLNACFDGLL 686