BLASTX nr result
ID: Akebia25_contig00021199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00021199 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON62499.1| hypothetical protein W97_01722 [Coniosporium apol... 60 2e-07 >gb|EON62499.1| hypothetical protein W97_01722 [Coniosporium apollinis CBS 100218] Length = 350 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 355 HQGEAVDLSGQDQPLENRESGLWIPASQHAQN 260 HQGE VDLS QD P+ENRESGLWIPASQHA N Sbjct: 289 HQGEGVDLSHQDAPMENRESGLWIPASQHAGN 320