BLASTX nr result
ID: Akebia25_contig00020953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00020953 (480 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006279812.1| hypothetical protein CARUB_v10028013mg [Caps... 44 8e-06 >ref|XP_006279812.1| hypothetical protein CARUB_v10028013mg [Capsella rubella] gi|387169570|gb|AFJ66229.1| hypothetical protein 34G24.15 [Capsella rubella] gi|482548516|gb|EOA12710.1| hypothetical protein CARUB_v10028013mg [Capsella rubella] Length = 435 Score = 43.9 bits (102), Expect(2) = 8e-06 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 5/55 (9%) Frame = +3 Query: 297 PPGGVWQDTKPPTIINNST--NPIK*RHHFAGQVILDSY---LYTTFIYLNSMGF 446 PPGG WQD+ P + N T N + H AGQ I+ ++ +T F++ N++GF Sbjct: 294 PPGGTWQDSSIPAVSQNKTSANATIQQAHIAGQSIMGTFNGIAFTMFVFFNTIGF 348 Score = 31.2 bits (69), Expect(2) = 8e-06 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +1 Query: 214 RKLPIDVRNALLVVFVLIATVTYQAAL 294 R P + R+ALLVV L+AT T+QA+L Sbjct: 266 RDSPSEARSALLVVASLVATATFQASL 292