BLASTX nr result
ID: Akebia25_contig00020931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00020931 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007215942.1| hypothetical protein PRUPE_ppa011224mg [Prun... 55 8e-06 gb|EXB74541.1| hypothetical protein L484_026238 [Morus notabilis] 55 1e-05 ref|NP_189412.1| protein EMBRYO DEFECTIVE 3123 [Arabidopsis thal... 55 1e-05 >ref|XP_007215942.1| hypothetical protein PRUPE_ppa011224mg [Prunus persica] gi|462412092|gb|EMJ17141.1| hypothetical protein PRUPE_ppa011224mg [Prunus persica] Length = 219 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = -1 Query: 113 SNNSNNYVTIRCGPRNNRGPLYKGRILSTEAMQAIQA 3 +N + +V++RCGPR+NRGPL KGR+LS EA+QA+QA Sbjct: 22 TNRTITHVSVRCGPRDNRGPLVKGRVLSIEAIQAVQA 58 >gb|EXB74541.1| hypothetical protein L484_026238 [Morus notabilis] Length = 238 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 104 SNNYVTIRCGPRNNRGPLYKGRILSTEAMQAIQA 3 +++Y IRCGPR+NRGPL KGRILS EA+QA+QA Sbjct: 29 TSSYAPIRCGPRDNRGPLVKGRILSIEAIQAVQA 62 >ref|NP_189412.1| protein EMBRYO DEFECTIVE 3123 [Arabidopsis thaliana] gi|9294480|dbj|BAB02699.1| unnamed protein product [Arabidopsis thaliana] gi|49660179|gb|AAT68380.1| hypothetical protein At3g27750 [Arabidopsis thaliana] gi|60547779|gb|AAX23853.1| hypothetical protein At3g27750 [Arabidopsis thaliana] gi|332643839|gb|AEE77360.1| protein EMBRYO DEFECTIVE 3123 [Arabidopsis thaliana] Length = 222 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -1 Query: 95 YVTIRCGPRNNRGPLYKGRILSTEAMQAIQA 3 +V+IRCGPR+NRGPL KGRILSTEA+Q+IQ+ Sbjct: 28 FVSIRCGPRDNRGPLLKGRILSTEAIQSIQS 58