BLASTX nr result
ID: Akebia25_contig00020748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00020748 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852513.1| hypothetical protein AMTR_s00021p00164610 [A... 56 6e-06 >ref|XP_006852513.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda] gi|548856124|gb|ERN13980.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda] Length = 574 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = -3 Query: 193 ESRSLIQNSSSTDDVDQSLFLLLKNPNTSKTCKHIYGFLPCTYNTEGHLFLIVNYEILLF 14 E+ LI + +S+ SL +L TS+TC+ YGFLPCT G+LFL++ Y L+F Sbjct: 30 ENSDLISDGASSSSSWSSLLVLKGKSATSETCEQTYGFLPCTSTVLGNLFLVIVYGYLMF 89 Query: 13 LG 8 LG Sbjct: 90 LG 91