BLASTX nr result
ID: Akebia25_contig00020536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00020536 (580 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 108 1e-21 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 108 1e-21 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 107 3e-21 ref|XP_381438.1| hypothetical protein FG01262.1 [Fusarium gramin... 107 3e-21 emb|CCT62031.1| related to ribosomal protein S28B [Fusarium fuji... 107 3e-21 gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis... 107 3e-21 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 107 3e-21 gb|EKJ79388.1| hypothetical protein FPSE_00430 [Fusarium pseudog... 107 3e-21 gb|EGU89241.1| hypothetical protein FOXB_00194 [Fusarium oxyspor... 107 3e-21 gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicol... 107 3e-21 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 106 4e-21 ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 106 4e-21 gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii A... 105 7e-21 gb|EMR69305.1| putative 40s ribosomal protein s28 protein [Eutyp... 105 7e-21 gb|EQB45990.1| ThiS family protein [Colletotrichum gloeosporioid... 105 9e-21 gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis A... 105 9e-21 gb|ENH88571.1| ribosomal protein s28e [Colletotrichum orbiculare... 105 9e-21 ref|XP_007277800.1| ribosomal protein s28e [Colletotrichum gloeo... 105 9e-21 ref|XP_003054121.1| predicted protein [Nectria haematococca mpVI... 105 9e-21 gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia... 105 1e-20 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botryotinia fuckeliana BcDW1] Length = 114 Score = 108 bits (270), Expect = 1e-21 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = +2 Query: 92 AKMDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 AKM+A+K P+KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 45 AKMEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 102 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] Length = 68 Score = 108 bits (270), Expect = 1e-21 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD+AK P+KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 107 bits (266), Expect = 3e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD+AKQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDILC 56 >ref|XP_381438.1| hypothetical protein FG01262.1 [Fusarium graminearum PH-1] Length = 171 Score = 107 bits (266), Expect = 3e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MDA+KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDASKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >emb|CCT62031.1| related to ribosomal protein S28B [Fusarium fujikuroi IMI 58289] Length = 166 Score = 107 bits (266), Expect = 3e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MDA+KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDASKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 107 bits (266), Expect = 3e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD+AK P+KLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRENDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 107 bits (266), Expect = 3e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 M++AK P+KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >gb|EKJ79388.1| hypothetical protein FPSE_00430 [Fusarium pseudograminearum CS3096] Length = 165 Score = 107 bits (266), Expect = 3e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MDA+KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDASKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EGU89241.1| hypothetical protein FOXB_00194 [Fusarium oxysporum Fo5176] gi|475668887|gb|EMT66673.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. cubense race 4] gi|477507310|gb|ENH60604.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. cubense race 1] gi|558856474|gb|ESU06557.1| hypothetical protein FGSG_11922 [Fusarium graminearum PH-1] gi|584128624|gb|EWG38043.1| 40S ribosomal protein S28 [Fusarium verticillioides 7600] gi|584128625|gb|EWG38044.1| 40S ribosomal protein S28 [Fusarium verticillioides 7600] gi|587672262|gb|EWY94603.1| 40S ribosomal protein S28 [Fusarium oxysporum FOSC 3-a] gi|587703480|gb|EWZ50085.1| 40S ribosomal protein S28 [Fusarium oxysporum Fo47] gi|587717137|gb|EWZ88474.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587756069|gb|EXA53785.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. pisi HDV247] gi|590045476|gb|EXK47334.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. melonis 26406] gi|590061735|gb|EXK89259.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. raphani 54005] gi|591413909|gb|EXL49046.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591443426|gb|EXL75989.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591443427|gb|EXL75990.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591479470|gb|EXM10530.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591499163|gb|EXM28601.1| 40S ribosomal protein S28 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596543630|gb|EYB23918.1| hypothetical protein FG05_11922 [Fusarium graminearum] Length = 68 Score = 107 bits (266), Expect = 3e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MDA+KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDASKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|380474013|emb|CCF46007.1| 40S ribosomal protein S28 [Colletotrichum higginsianum] gi|573067571|gb|ETS87099.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] Length = 68 Score = 107 bits (266), Expect = 3e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD+AKQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 106 bits (265), Expect = 4e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MDA+K P+KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] Length = 68 Score = 106 bits (265), Expect = 4e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD+AK P+KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii ATCC 58251] Length = 68 Score = 105 bits (263), Expect = 7e-21 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD++KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EMR69305.1| putative 40s ribosomal protein s28 protein [Eutypa lata UCREL1] Length = 68 Score = 105 bits (263), Expect = 7e-21 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD+AKQP+KLV+VTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKQPVKLVRVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EQB45990.1| ThiS family protein [Colletotrichum gloeosporioides Cg-14] Length = 162 Score = 105 bits (262), Expect = 9e-21 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD+ KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDSTKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] Length = 68 Score = 105 bits (262), Expect = 9e-21 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD++K P+KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|ENH88571.1| ribosomal protein s28e [Colletotrichum orbiculare MAFF 240422] Length = 68 Score = 105 bits (262), Expect = 9e-21 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD++KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSI+RNVKGPVRE+DILC Sbjct: 1 MDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIVRNVKGPVREDDILC 56 >ref|XP_007277800.1| ribosomal protein s28e [Colletotrichum gloeosporioides Nara gc5] gi|429858281|gb|ELA33106.1| ribosomal protein s28e [Colletotrichum gloeosporioides Nara gc5] Length = 68 Score = 105 bits (262), Expect = 9e-21 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MD+ KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MDSTKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_003054121.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256735062|gb|EEU48408.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 195 Score = 105 bits (262), Expect = 9e-21 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 MDA+KQP+KLVKVTRVLGRTGSRGGVTQVRVEFMDD +RSIIRNVKGPVRE+DILC Sbjct: 1 MDASKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQSRSIIRNVKGPVREDDILC 56 >gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] Length = 68 Score = 105 bits (261), Expect = 1e-20 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +2 Query: 98 MDAAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 265 M++AK P+KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56