BLASTX nr result
ID: Akebia25_contig00020092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00020092 (649 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148616.1| PREDICTED: LIMR family protein At3g08930-lik... 60 4e-07 ref|XP_006429390.1| hypothetical protein CICLE_v10011517mg [Citr... 60 6e-07 ref|XP_004492444.1| PREDICTED: LIMR family protein At5g01460-lik... 60 6e-07 ref|XP_007205059.1| hypothetical protein PRUPE_ppa004457mg [Prun... 60 6e-07 ref|XP_003552245.1| PREDICTED: LIMR family protein At5g01460-lik... 60 6e-07 ref|XP_003520496.1| PREDICTED: LIMR family protein At3g08930-lik... 60 6e-07 gb|EYU26666.1| hypothetical protein MIMGU_mgv1a004810mg [Mimulus... 59 1e-06 ref|XP_006365594.1| PREDICTED: LIMR family protein At5g01460-lik... 59 1e-06 ref|XP_006398614.1| hypothetical protein EUTSA_v10013023mg [Eutr... 59 1e-06 ref|XP_006299427.1| hypothetical protein CARUB_v10015588mg [Caps... 59 1e-06 ref|XP_006287547.1| hypothetical protein CARUB_v10000756mg [Caps... 59 1e-06 ref|XP_004246766.1| PREDICTED: LIMR family protein At5g01460-lik... 59 1e-06 ref|XP_002882590.1| hypothetical protein ARALYDRAFT_478196 [Arab... 59 1e-06 ref|XP_002873012.1| LMBR1 integral membrane family protein [Arab... 59 1e-06 ref|XP_002323579.1| LMBR1 integral membrane family protein [Popu... 59 1e-06 ref|XP_002308217.1| LMBR1 integral membrane family protein [Popu... 59 1e-06 ref|XP_002280330.1| PREDICTED: LIMR family protein At5g01460 [Vi... 59 1e-06 gb|AAF07832.1|AC010871_8 unknown protein [Arabidopsis thaliana] 59 1e-06 ref|NP_566338.2| LMBR1-like membrane protein [Arabidopsis thalia... 59 1e-06 ref|NP_195766.1| LMBR1-like membrane protein [Arabidopsis thalia... 59 1e-06 >ref|XP_004148616.1| PREDICTED: LIMR family protein At3g08930-like [Cucumis sativus] gi|449522716|ref|XP_004168372.1| PREDICTED: LIMR family protein At3g08930-like [Cucumis sativus] Length = 509 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AFHWTSK 124 IHPMKWGATLMNSFLFNVGLILLCSI S AF + ++ Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCSTAFAYYAR 449 >ref|XP_006429390.1| hypothetical protein CICLE_v10011517mg [Citrus clementina] gi|568854868|ref|XP_006481038.1| PREDICTED: LIMR family protein At5g01460-like [Citrus sinensis] gi|557531447|gb|ESR42630.1| hypothetical protein CICLE_v10011517mg [Citrus clementina] Length = 510 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI S AF Sbjct: 410 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCSTAF 445 >ref|XP_004492444.1| PREDICTED: LIMR family protein At5g01460-like [Cicer arietinum] Length = 509 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI S AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCSTAF 444 >ref|XP_007205059.1| hypothetical protein PRUPE_ppa004457mg [Prunus persica] gi|462400701|gb|EMJ06258.1| hypothetical protein PRUPE_ppa004457mg [Prunus persica] Length = 508 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI S AF Sbjct: 408 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCSTAF 443 >ref|XP_003552245.1| PREDICTED: LIMR family protein At5g01460-like [Glycine max] Length = 509 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI S AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCSTAF 444 >ref|XP_003520496.1| PREDICTED: LIMR family protein At3g08930-like [Glycine max] Length = 508 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI S AF Sbjct: 408 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCSTAF 443 >gb|EYU26666.1| hypothetical protein MIMGU_mgv1a004810mg [Mimulus guttatus] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_006365594.1| PREDICTED: LIMR family protein At5g01460-like [Solanum tuberosum] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_006398614.1| hypothetical protein EUTSA_v10013023mg [Eutrema salsugineum] gi|557099704|gb|ESQ40067.1| hypothetical protein EUTSA_v10013023mg [Eutrema salsugineum] Length = 599 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 499 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 534 >ref|XP_006299427.1| hypothetical protein CARUB_v10015588mg [Capsella rubella] gi|482568136|gb|EOA32325.1| hypothetical protein CARUB_v10015588mg [Capsella rubella] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_006287547.1| hypothetical protein CARUB_v10000756mg [Capsella rubella] gi|482556253|gb|EOA20445.1| hypothetical protein CARUB_v10000756mg [Capsella rubella] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_004246766.1| PREDICTED: LIMR family protein At5g01460-like [Solanum lycopersicum] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_002882590.1| hypothetical protein ARALYDRAFT_478196 [Arabidopsis lyrata subsp. lyrata] gi|297328430|gb|EFH58849.1| hypothetical protein ARALYDRAFT_478196 [Arabidopsis lyrata subsp. lyrata] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_002873012.1| LMBR1 integral membrane family protein [Arabidopsis lyrata subsp. lyrata] gi|297318849|gb|EFH49271.1| LMBR1 integral membrane family protein [Arabidopsis lyrata subsp. lyrata] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_002323579.1| LMBR1 integral membrane family protein [Populus trichocarpa] gi|222868209|gb|EEF05340.1| LMBR1 integral membrane family protein [Populus trichocarpa] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_002308217.1| LMBR1 integral membrane family protein [Populus trichocarpa] gi|222854193|gb|EEE91740.1| LMBR1 integral membrane family protein [Populus trichocarpa] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|XP_002280330.1| PREDICTED: LIMR family protein At5g01460 [Vitis vinifera] gi|297740207|emb|CBI30389.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >gb|AAF07832.1|AC010871_8 unknown protein [Arabidopsis thaliana] Length = 482 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 393 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 428 >ref|NP_566338.2| LMBR1-like membrane protein [Arabidopsis thaliana] gi|226789815|sp|Q9SR93.2|LMBD1_ARATH RecName: Full=LIMR family protein At3g08930 gi|14334836|gb|AAK59596.1| unknown protein [Arabidopsis thaliana] gi|24417362|gb|AAN60291.1| unknown [Arabidopsis thaliana] gi|56550703|gb|AAV97805.1| At3g08930 [Arabidopsis thaliana] gi|332641175|gb|AEE74696.1| LMBR1-like membrane protein [Arabidopsis thaliana] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444 >ref|NP_195766.1| LMBR1-like membrane protein [Arabidopsis thaliana] gi|75181394|sp|Q9M028.1|LMBD2_ARATH RecName: Full=LIMR family protein At5g01460 gi|7320724|emb|CAB81929.1| putative protein [Arabidopsis thaliana] gi|18176296|gb|AAL60018.1| unknown protein [Arabidopsis thaliana] gi|20465353|gb|AAM20080.1| unknown protein [Arabidopsis thaliana] gi|332002964|gb|AED90347.1| LMBR1-like membrane protein [Arabidopsis thaliana] Length = 509 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 2 IHPMKWGATLMNSFLFNVGLILLCSIRYAYLIS*AF 109 IHPMKWGATLMNSFLFNVGLILLCSI + AF Sbjct: 409 IHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAF 444