BLASTX nr result
ID: Akebia25_contig00019990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00019990 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517217.1| brushy protein, putative [Ricinus communis] ... 42 4e-06 >ref|XP_002517217.1| brushy protein, putative [Ricinus communis] gi|223543588|gb|EEF45117.1| brushy protein, putative [Ricinus communis] Length = 1327 Score = 42.0 bits (97), Expect(2) = 4e-06 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +2 Query: 170 DVSLISLLRSIKTFSKPKTSELEKPSV-SKLTEASPTGLSK*IDNQHRLTGRKRVRV 337 D+ LISLL+ K S+ KT+ +E + KL E SP LSK NQ + GRKRVRV Sbjct: 551 DLPLISLLQPSKQASRKKTACIENCNTCDKLAEVSPKCLSK-TSNQQTVVGRKRVRV 606 Score = 34.3 bits (77), Expect(2) = 4e-06 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 64 DDDLPDNRSNAYNSPKITESASTRSR-LNNFEEVKD 168 DDD DNRSN +SPK S T+S+ L EE+ D Sbjct: 515 DDDFSDNRSNPSHSPKNNSSGCTKSKNLAGVEELND 550