BLASTX nr result
ID: Akebia25_contig00019748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00019748 (565 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209902.1| hypothetical protein PRUPE_ppa004161mg [Prun... 82 1e-13 emb|CAN71929.1| hypothetical protein VITISV_001044 [Vitis vinifera] 80 3e-13 ref|XP_002279150.1| PREDICTED: two-component response regulator-... 79 6e-13 ref|XP_007155750.1| hypothetical protein PHAVU_003G228600g [Phas... 79 8e-13 ref|XP_003550939.1| PREDICTED: two-component response regulator-... 79 8e-13 ref|XP_004148499.1| PREDICTED: two-component response regulator-... 78 1e-12 gb|EXB99793.1| Two-component response regulator-like protein [Mo... 77 2e-12 ref|XP_004300274.1| PREDICTED: two-component response regulator-... 77 3e-12 ref|XP_006579673.1| PREDICTED: two-component response regulator-... 77 4e-12 ref|XP_006579672.1| PREDICTED: two-component response regulator-... 77 4e-12 ref|XP_006436789.1| hypothetical protein CICLE_v10031120mg [Citr... 77 4e-12 ref|XP_007039578.1| CheY-like two-component responsive regulator... 77 4e-12 ref|XP_006847667.1| hypothetical protein AMTR_s00149p00035260 [A... 76 7e-12 ref|XP_002527635.1| transcription factor, putative [Ricinus comm... 76 7e-12 ref|XP_006368450.1| hypothetical protein POPTR_0001s02910g [Popu... 75 9e-12 ref|XP_006368444.1| hypothetical protein POPTR_0001s02910g [Popu... 75 9e-12 ref|XP_006361171.1| PREDICTED: two-component response regulator-... 75 1e-11 ref|XP_004508999.1| PREDICTED: two-component response regulator-... 74 2e-11 ref|XP_004241977.1| PREDICTED: two-component response regulator-... 74 2e-11 ref|NP_567548.1| pseudo-response regulator 2 [Arabidopsis thali... 74 3e-11 >ref|XP_007209902.1| hypothetical protein PRUPE_ppa004161mg [Prunus persica] gi|462405637|gb|EMJ11101.1| hypothetical protein PRUPE_ppa004161mg [Prunus persica] Length = 526 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEV+D+VVKEA+SKPW PLPLGLKPPSTE VL EL RQGIC +PP Sbjct: 474 EEVVDKVVKEAISKPWLPLPLGLKPPSTEGVLDELSRQGICNIPP 518 >emb|CAN71929.1| hypothetical protein VITISV_001044 [Vitis vinifera] Length = 563 Score = 80.5 bits (197), Expect = 3e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVIDRVVKEA+SKPW PLPLGLKPP+TESVL+EL RQGI +PP Sbjct: 511 EEVIDRVVKEAISKPWMPLPLGLKPPATESVLAELSRQGISTIPP 555 >ref|XP_002279150.1| PREDICTED: two-component response regulator-like APRR2 [Vitis vinifera] gi|297742160|emb|CBI33947.3| unnamed protein product [Vitis vinifera] Length = 557 Score = 79.3 bits (194), Expect = 6e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EE+IDRVVKEA+SKPW PLPLGLKPP+TESVL+EL RQGI +PP Sbjct: 505 EELIDRVVKEAISKPWMPLPLGLKPPATESVLAELSRQGISTIPP 549 >ref|XP_007155750.1| hypothetical protein PHAVU_003G228600g [Phaseolus vulgaris] gi|561029104|gb|ESW27744.1| hypothetical protein PHAVU_003G228600g [Phaseolus vulgaris] Length = 559 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPPES 423 +EV+D+VVKEA+SKPW PLPLGLKPPST+SVL+EL RQGI +PP S Sbjct: 506 QEVVDKVVKEAVSKPWLPLPLGLKPPSTDSVLAELSRQGISSIPPRS 552 >ref|XP_003550939.1| PREDICTED: two-component response regulator-like APRR2-like [Glycine max] Length = 576 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPPE 426 EEV+D+VVKEA++KPW PLPLGLKPPSTESVL+EL RQGI +PP+ Sbjct: 526 EEVVDKVVKEAINKPWLPLPLGLKPPSTESVLAELSRQGISNIPPK 571 >ref|XP_004148499.1| PREDICTED: two-component response regulator-like APRR2-like [Cucumis sativus] gi|449530967|ref|XP_004172463.1| PREDICTED: two-component response regulator-like APRR2-like [Cucumis sativus] Length = 521 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPPE 426 EEV+D++VKEAM KPW PLPLGLKPPSTESVL+EL ++GI VPP+ Sbjct: 469 EEVVDKIVKEAMKKPWSPLPLGLKPPSTESVLTELSKKGISTVPPQ 514 >gb|EXB99793.1| Two-component response regulator-like protein [Morus notabilis] Length = 596 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVID+VVKEA++KPW PLPLGLKPPS +SVLSEL RQGI ++PP Sbjct: 535 EEVIDKVVKEAINKPWLPLPLGLKPPSADSVLSELSRQGISKIPP 579 >ref|XP_004300274.1| PREDICTED: two-component response regulator-like APRR2-like [Fragaria vesca subsp. vesca] Length = 581 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EE+ID+V+KEA+SKPW PLPLGLK PSTE VL+EL RQGIC +PP Sbjct: 529 EEIIDKVMKEAISKPWLPLPLGLKLPSTEGVLAELSRQGICNIPP 573 >ref|XP_006579673.1| PREDICTED: two-component response regulator-like APRR2-like isoform X2 [Glycine max] Length = 553 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPPE 426 EEV+D+VVKEA+SKPW PLPLGLKPPS +SVL+EL RQGI +PP+ Sbjct: 503 EEVVDKVVKEAISKPWLPLPLGLKPPSPDSVLAELSRQGISNIPPK 548 >ref|XP_006579672.1| PREDICTED: two-component response regulator-like APRR2-like isoform X1 [Glycine max] Length = 571 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPPE 426 EEV+D+VVKEA+SKPW PLPLGLKPPS +SVL+EL RQGI +PP+ Sbjct: 521 EEVVDKVVKEAISKPWLPLPLGLKPPSPDSVLAELSRQGISNIPPK 566 >ref|XP_006436789.1| hypothetical protein CICLE_v10031120mg [Citrus clementina] gi|568864005|ref|XP_006485404.1| PREDICTED: two-component response regulator-like APRR2-like isoform X1 [Citrus sinensis] gi|568864007|ref|XP_006485405.1| PREDICTED: two-component response regulator-like APRR2-like isoform X2 [Citrus sinensis] gi|557538985|gb|ESR50029.1| hypothetical protein CICLE_v10031120mg [Citrus clementina] Length = 559 Score = 76.6 bits (187), Expect = 4e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVID+VVKEA+SKPW PLPLGLKPPS +SVL+EL RQGI +PP Sbjct: 507 EEVIDKVVKEAISKPWLPLPLGLKPPSADSVLAELSRQGISTIPP 551 >ref|XP_007039578.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] gi|590675897|ref|XP_007039580.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] gi|508776823|gb|EOY24079.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] gi|508776825|gb|EOY24081.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] Length = 556 Score = 76.6 bits (187), Expect = 4e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVID VVKEA++KPW PLPLGLKPPSTE VL+EL RQGI VPP Sbjct: 505 EEVIDNVVKEAINKPWLPLPLGLKPPSTEGVLAELSRQGISAVPP 549 >ref|XP_006847667.1| hypothetical protein AMTR_s00149p00035260 [Amborella trichopoda] gi|548850936|gb|ERN09248.1| hypothetical protein AMTR_s00149p00035260 [Amborella trichopoda] Length = 575 Score = 75.9 bits (185), Expect = 7e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 E VID VVKEA+SKPW PLPLGL PPST+SVLSEL RQGI +PP Sbjct: 513 ESVIDEVVKEAISKPWLPLPLGLNPPSTDSVLSELQRQGITSIPP 557 >ref|XP_002527635.1| transcription factor, putative [Ricinus communis] gi|223532940|gb|EEF34706.1| transcription factor, putative [Ricinus communis] Length = 478 Score = 75.9 bits (185), Expect = 7e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVID+VVKEA++KPW PLPLGLKPPST+ VL+EL RQGI VPP Sbjct: 426 EEVIDKVVKEAINKPWLPLPLGLKPPSTDLVLAELSRQGISRVPP 470 >ref|XP_006368450.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346364|gb|ERP65019.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] Length = 537 Score = 75.5 bits (184), Expect = 9e-12 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVID+VVKEA++KPW PLPLGLKPPS +SVL+EL RQG+ +PP Sbjct: 485 EEVIDKVVKEAINKPWLPLPLGLKPPSADSVLAELSRQGVSSIPP 529 >ref|XP_006368444.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|566146883|ref|XP_006368445.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346358|gb|ERP65013.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] gi|550346359|gb|ERP65014.1| hypothetical protein POPTR_0001s02910g [Populus trichocarpa] Length = 481 Score = 75.5 bits (184), Expect = 9e-12 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVID+VVKEA++KPW PLPLGLKPPS +SVL+EL RQG+ +PP Sbjct: 429 EEVIDKVVKEAINKPWLPLPLGLKPPSADSVLAELSRQGVSSIPP 473 >ref|XP_006361171.1| PREDICTED: two-component response regulator-like APRR2-like isoform X1 [Solanum tuberosum] gi|565390903|ref|XP_006361172.1| PREDICTED: two-component response regulator-like APRR2-like isoform X2 [Solanum tuberosum] Length = 554 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVID+VVKEA++KPW PLPLGLKPPSTESVL L +QGI VPP Sbjct: 501 EEVIDKVVKEAINKPWLPLPLGLKPPSTESVLDALSKQGISTVPP 545 >ref|XP_004508999.1| PREDICTED: two-component response regulator-like APRR2-like isoform X1 [Cicer arietinum] gi|502152596|ref|XP_004509000.1| PREDICTED: two-component response regulator-like APRR2-like isoform X2 [Cicer arietinum] Length = 549 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPPES 423 EEV+D+VVKE +SKPW PLP+GLKPPST+SVL+E+ RQG +PP S Sbjct: 497 EEVVDKVVKEVISKPWLPLPIGLKPPSTDSVLAEISRQGSSTIPPSS 543 >ref|XP_004241977.1| PREDICTED: two-component response regulator-like APRR2-like [Solanum lycopersicum] Length = 559 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPP 429 EEVID+VVKEA++KPW PLPLGLKPPSTESVL L +QGI VPP Sbjct: 506 EEVIDKVVKEAINKPWLPLPLGLKPPSTESVLDALSKQGIPAVPP 550 >ref|NP_567548.1| pseudo-response regulator 2 [Arabidopsis thaliana] gi|30684266|ref|NP_849403.1| pseudo-response regulator 2 [Arabidopsis thaliana] gi|145361326|ref|NP_849404.2| pseudo-response regulator 2 [Arabidopsis thaliana] gi|334186660|ref|NP_001190759.1| pseudo-response regulator 2 [Arabidopsis thaliana] gi|52783226|sp|Q6LA43.2|APRR2_ARATH RecName: Full=Two-component response regulator-like APRR2; AltName: Full=Pseudo-response regulator 2; AltName: Full=TOC2 protein gi|14326543|gb|AAK60316.1|AF385725_1 AT4g18020/T6K21_200 [Arabidopsis thaliana] gi|23506085|gb|AAN28902.1| At4g18020/T6K21_200 [Arabidopsis thaliana] gi|332658580|gb|AEE83980.1| pseudo-response regulator 2 [Arabidopsis thaliana] gi|332658581|gb|AEE83981.1| pseudo-response regulator 2 [Arabidopsis thaliana] gi|332658582|gb|AEE83982.1| pseudo-response regulator 2 [Arabidopsis thaliana] gi|332658585|gb|AEE83985.1| pseudo-response regulator 2 [Arabidopsis thaliana] Length = 535 Score = 73.9 bits (180), Expect = 3e-11 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -3 Query: 563 EEVIDRVVKEAMSKPWQPLPLGLKPPSTESVLSELHRQGICEVPPES 423 EE++D+VVKEA+SKPW PLPLGLKPPS ESVL+EL RQGI VP S Sbjct: 479 EEMLDQVVKEAISKPWLPLPLGLKPPSAESVLAELTRQGISAVPSSS 525