BLASTX nr result
ID: Akebia25_contig00019702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00019702 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME78027.1| hypothetical protein MYCFIDRAFT_57482 [Pseudocerc... 63 4e-08 gb|EMF08980.1| ubiquitin-like protein [Sphaerulina musiva SO2202] 62 6e-08 gb|EME39742.1| hypothetical protein DOTSEDRAFT_65695 [Dothistrom... 57 4e-06 >gb|EME78027.1| hypothetical protein MYCFIDRAFT_57482 [Pseudocercospora fijiensis CIRAD86] Length = 172 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 224 EPEPTMQVFIKNIAGDTFPLQIPESTTVSTLRS 322 EPEPTMQ+F+KN+AGDTFP+ IPESTTV TLRS Sbjct: 20 EPEPTMQIFVKNVAGDTFPITIPESTTVGTLRS 52 >gb|EMF08980.1| ubiquitin-like protein [Sphaerulina musiva SO2202] Length = 172 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 224 EPEPTMQVFIKNIAGDTFPLQIPESTTVSTLRS 322 EPEPTMQ+F+K+IAG+TFPL IPESTTVSTLRS Sbjct: 20 EPEPTMQIFVKDIAGETFPLTIPESTTVSTLRS 52 >gb|EME39742.1| hypothetical protein DOTSEDRAFT_65695 [Dothistroma septosporum NZE10] Length = 171 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 224 EPEPTMQVFIKNIAGDTFPLQIPESTTVSTLRS 322 EPEPTMQ+F+K+I GDTFP+ IPEST+V TLR+ Sbjct: 20 EPEPTMQIFVKSIQGDTFPITIPESTSVHTLRA 52