BLASTX nr result
ID: Akebia25_contig00019215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00019215 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842227.1| hypothetical protein AMTR_s00078p00183610 [A... 55 8e-06 >ref|XP_006842227.1| hypothetical protein AMTR_s00078p00183610 [Amborella trichopoda] gi|548844276|gb|ERN03902.1| hypothetical protein AMTR_s00078p00183610 [Amborella trichopoda] Length = 547 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = -2 Query: 366 DFPSLETIDIEDCPKLKRLPFGPHTAPNLKEFQCEEEWFKGLEW 235 ++PSLETID+ CP L RLPF +A LK + E+EW++GLEW Sbjct: 478 NWPSLETIDVGKCPSLTRLPFDARSAQCLKYIRGEKEWWEGLEW 521