BLASTX nr result
ID: Akebia25_contig00017258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00017258 (1428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEJ72569.1| putative reverse transcriptase family member [Mal... 59 4e-06 gb|ABN08556.1| Polyprotein, putative [Medicago truncatula] 59 4e-06 ref|XP_003593597.1| Telomerase-binding protein EST1A [Medicago t... 59 7e-06 gb|ABD32368.2| RNA-directed DNA polymerase ; HMG-I and HMG-Y, DN... 59 7e-06 >gb|AEJ72569.1| putative reverse transcriptase family member [Malus domestica] Length = 212 Score = 59.3 bits (142), Expect = 4e-06 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 4/61 (6%) Frame = +2 Query: 38 LCDRCILSKLKGRFYKTAIRSTMINKAECWAVK-KHVRRISAVEKSTLSQMSG---KSKI 205 LCDRC+ KLKG+FY+T IR M+ ECWAVK +HV ++ E L M G K KI Sbjct: 58 LCDRCMPLKLKGKFYRTTIRPAMLYGTECWAVKYQHVHKMGVAEMRMLRWMCGHTRKDKI 117 Query: 206 R 208 R Sbjct: 118 R 118 >gb|ABN08556.1| Polyprotein, putative [Medicago truncatula] Length = 137 Score = 59.3 bits (142), Expect = 4e-06 Identities = 33/79 (41%), Positives = 49/79 (62%), Gaps = 9/79 (11%) Frame = +2 Query: 38 LCDRCILSKLKGRFYKTAIRSTMINKAECWAVK-KHVRRISAVEKSTLSQMSGKSK---- 202 LCD+ + KLKG+FY+TA+R ++ ECWAVK +H ++S VE L MSGK++ Sbjct: 44 LCDKKVPLKLKGKFYRTAVRPALLYGTECWAVKSQHENQVSVVEMRMLRWMSGKTRHDRI 103 Query: 203 ----IRQN*KLAHLMEILV 247 IR+ +A ++E LV Sbjct: 104 RNDTIRERVGVAPIVEKLV 122 >ref|XP_003593597.1| Telomerase-binding protein EST1A [Medicago truncatula] gi|355482645|gb|AES63848.1| Telomerase-binding protein EST1A [Medicago truncatula] Length = 1189 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = +2 Query: 38 LCDRCILSKLKGRFYKTAIRSTMINKAECWAVK-KHVRRISAVEKSTLSQMSGKSK 202 LCD+ +L KLKG+FY+T +R T++ ECW VK +H ++S E L MSGK++ Sbjct: 1047 LCDKKVLLKLKGKFYRTTVRPTLLYGTECWTVKSQHENQVSVAEMMMLRWMSGKTR 1102 >gb|ABD32368.2| RNA-directed DNA polymerase ; HMG-I and HMG-Y, DNA-binding, putative [Medicago truncatula] Length = 118 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = +2 Query: 38 LCDRCILSKLKGRFYKTAIRSTMINKAECWAVK-KHVRRISAVEKSTLSQMSGKSK 202 LCD+ +L KLKG+FY+T +R T++ ECW VK +H ++S E L MSGK++ Sbjct: 45 LCDKKVLLKLKGKFYRTTVRPTLLYGTECWTVKSQHENQVSVAEMMMLRWMSGKTR 100