BLASTX nr result
ID: Akebia25_contig00016800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00016800 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON61935.1| hypothetical protein W97_01153 [Coniosporium apol... 60 4e-07 >gb|EON61935.1| hypothetical protein W97_01153 [Coniosporium apollinis CBS 100218] Length = 740 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 7/64 (10%) Frame = +1 Query: 172 MSSPSVHPRRRAQRLSSPNI-------RKSETFSARTGLRSDLCNPRDNASFLPKRSHTT 330 M+S +HPRRR Q + P++ RKS TF + TGL S+LC+P D+A +LP+RS T+ Sbjct: 1 MASSQIHPRRRPQMGAGPHVETRDLQFRKSSTFHSPTGLLSELCDPIDHARYLPRRSPTS 60 Query: 331 LEDL 342 +DL Sbjct: 61 PQDL 64