BLASTX nr result
ID: Akebia25_contig00016545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00016545 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton ... 144 1e-32 ref|XP_006492091.1| PREDICTED: pyrophosphate-energized vacuolar ... 144 1e-32 ref|XP_006427441.1| hypothetical protein CICLE_v10024946mg [Citr... 144 1e-32 gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea] 144 1e-32 ref|XP_003531725.1| PREDICTED: pyrophosphate-energized vacuolar ... 144 1e-32 ref|XP_003528302.1| PREDICTED: pyrophosphate-energized vacuolar ... 144 1e-32 gb|EYU21676.1| hypothetical protein MIMGU_mgv1a001720mg [Mimulus... 143 2e-32 ref|XP_006341399.1| PREDICTED: pyrophosphate-energized vacuolar ... 143 2e-32 ref|XP_004241690.1| PREDICTED: pyrophosphate-energized vacuolar ... 143 2e-32 ref|XP_004235902.1| PREDICTED: pyrophosphate-energized vacuolar ... 143 2e-32 emb|CAA54869.1| inorganic pyrophosphatase [Nicotiana tabacum] 143 2e-32 gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton ... 143 3e-32 ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar ... 143 3e-32 ref|XP_007217159.1| hypothetical protein PRUPE_ppa001776mg [Prun... 143 3e-32 gb|AET95912.1| PHP1 [Lagenaria siceraria] 143 3e-32 emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] 143 3e-32 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus... 143 3e-32 ref|XP_003632833.1| PREDICTED: pyrophosphate-energized vacuolar ... 143 3e-32 ref|XP_003632767.1| PREDICTED: pyrophosphate-energized vacuolar ... 143 3e-32 ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane pr... 143 3e-32 >gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 765 Score = 144 bits (363), Expect = 1e-32 Identities = 71/74 (95%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 692 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 751 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 752 PFFATHGGLLFKIF 765 >ref|XP_006492091.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1 [Citrus sinensis] Length = 766 Score = 144 bits (363), Expect = 1e-32 Identities = 71/74 (95%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 693 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 752 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 753 PFFATHGGLLFKIF 766 >ref|XP_006427441.1| hypothetical protein CICLE_v10024946mg [Citrus clementina] gi|557529431|gb|ESR40681.1| hypothetical protein CICLE_v10024946mg [Citrus clementina] Length = 766 Score = 144 bits (363), Expect = 1e-32 Identities = 71/74 (95%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 693 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 752 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 753 PFFATHGGLLFKIF 766 >gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea] Length = 763 Score = 144 bits (363), Expect = 1e-32 Identities = 71/74 (95%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 689 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 748 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 749 PFFATHGGLLFKIF 762 >ref|XP_003531725.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Glycine max] Length = 768 Score = 144 bits (363), Expect = 1e-32 Identities = 71/74 (95%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 695 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 754 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 755 PFFATHGGLLFKIF 768 >ref|XP_003528302.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Glycine max] Length = 768 Score = 144 bits (363), Expect = 1e-32 Identities = 71/74 (95%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 695 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 754 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 755 PFFATHGGLLFKIF 768 >gb|EYU21676.1| hypothetical protein MIMGU_mgv1a001720mg [Mimulus guttatus] Length = 769 Score = 143 bits (361), Expect = 2e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 696 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 755 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFK+F Sbjct: 756 PFFATHGGLLFKLF 769 >ref|XP_006341399.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Solanum tuberosum] Length = 767 Score = 143 bits (361), Expect = 2e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 694 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 753 Query: 183 PFFVRHGGLLFKIF 224 PFF HGG+LFKIF Sbjct: 754 PFFATHGGILFKIF 767 >ref|XP_004241690.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Solanum lycopersicum] Length = 767 Score = 143 bits (361), Expect = 2e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 694 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 753 Query: 183 PFFVRHGGLLFKIF 224 PFF HGG+LFKIF Sbjct: 754 PFFATHGGILFKIF 767 >ref|XP_004235902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Solanum lycopersicum] Length = 767 Score = 143 bits (361), Expect = 2e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 694 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 753 Query: 183 PFFVRHGGLLFKIF 224 PFF HGG+LFKIF Sbjct: 754 PFFATHGGILFKIF 767 >emb|CAA54869.1| inorganic pyrophosphatase [Nicotiana tabacum] Length = 764 Score = 143 bits (361), Expect = 2e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 691 AKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 750 Query: 183 PFFVRHGGLLFKIF 224 PFF HGG+LFKIF Sbjct: 751 PFFATHGGILFKIF 764 >gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 764 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 691 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 750 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 751 PFFATHGGLLFKIF 764 >ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Fragaria vesca subsp. vesca] Length = 767 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 694 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 753 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 754 PFFATHGGLLFKIF 767 >ref|XP_007217159.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica] gi|462413309|gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica] Length = 767 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 694 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 753 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 754 PFFATHGGLLFKIF 767 >gb|AET95912.1| PHP1 [Lagenaria siceraria] Length = 768 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 695 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 754 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 755 PFFASHGGLLFKIF 768 >emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] Length = 765 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 692 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 751 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 752 PFFATHGGLLFKIF 765 >dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis] Length = 767 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 694 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 753 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 754 PFFATHGGLLFKIF 767 >ref|XP_003632833.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Vitis vinifera] Length = 418 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 345 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 404 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 405 PFFATHGGLLFKIF 418 >ref|XP_003632767.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Vitis vinifera] gi|297743533|emb|CBI36400.3| unnamed protein product [Vitis vinifera] Length = 395 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 322 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 381 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 382 PFFATHGGLLFKIF 395 >ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane proton pump, putative [Ricinus communis] gi|223529671|gb|EEF31615.1| Pyrophosphate-energized vacuolar membrane proton pump, putative [Ricinus communis] Length = 767 Score = 143 bits (360), Expect = 3e-32 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = +3 Query: 3 AKKYIEAGGSEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 182 AKKYIEAG SEHARTLGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA Sbjct: 694 AKKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFA 753 Query: 183 PFFVRHGGLLFKIF 224 PFF HGGLLFKIF Sbjct: 754 PFFATHGGLLFKIF 767