BLASTX nr result
ID: Akebia25_contig00016060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00016060 (499 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510746.1| Squamosa promoter-binding protein, putative ... 57 4e-06 ref|XP_002307005.2| hypothetical protein POPTR_0005s28010g [Popu... 56 5e-06 >ref|XP_002510746.1| Squamosa promoter-binding protein, putative [Ricinus communis] gi|223551447|gb|EEF52933.1| Squamosa promoter-binding protein, putative [Ricinus communis] Length = 1073 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 142 MEELGAQVAHPFFIHQAIPGGFREVASMAKKRDLPWQNPNF 20 MEE+GAQVA P FIHQA+ F + ASMAKKRDL +Q NF Sbjct: 1 MEEVGAQVASPIFIHQALSSRFCDAASMAKKRDLSYQTSNF 41 >ref|XP_002307005.2| hypothetical protein POPTR_0005s28010g [Populus trichocarpa] gi|550339907|gb|EEE94001.2| hypothetical protein POPTR_0005s28010g [Populus trichocarpa] Length = 1039 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 142 MEELGAQVAHPFFIHQAIPGGFREVASMAKKRDLPWQNPNF 20 ME++GAQVA P FIHQA+ + ++ASMAKKRDL +Q PNF Sbjct: 1 MEKVGAQVAAPMFIHQALSSRYCDLASMAKKRDLSYQMPNF 41