BLASTX nr result
ID: Akebia25_contig00015559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00015559 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050340.1| 2-oxoglutarate and Fe(II)-dependent oxygenas... 57 3e-06 ref|XP_007050339.1| 2-oxoglutarate and Fe(II)-dependent oxygenas... 57 3e-06 gb|ABK96309.1| unknown [Populus trichocarpa x Populus deltoides] 57 3e-06 ref|XP_002284676.2| PREDICTED: 1-aminocyclopropane-1-carboxylate... 56 6e-06 emb|CBI23602.3| unnamed protein product [Vitis vinifera] 56 6e-06 emb|CAN80594.1| hypothetical protein VITISV_017626 [Vitis vinifera] 56 6e-06 ref|XP_002315711.2| hypothetical protein POPTR_0010s08380g [Popu... 55 8e-06 >ref|XP_007050340.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein isoform 2 [Theobroma cacao] gi|508702601|gb|EOX94497.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein isoform 2 [Theobroma cacao] Length = 366 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -3 Query: 284 NPPIYKDILITEFFAFYKSKGLDGNSALPHFKL 186 NPPIY++ +TE+ A+++SKGLDGNS+LPHFKL Sbjct: 333 NPPIYRETHVTEYMAYFRSKGLDGNSSLPHFKL 365 >ref|XP_007050339.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein isoform 1 [Theobroma cacao] gi|508702600|gb|EOX94496.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein isoform 1 [Theobroma cacao] Length = 392 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -3 Query: 284 NPPIYKDILITEFFAFYKSKGLDGNSALPHFKL 186 NPPIY++ +TE+ A+++SKGLDGNS+LPHFKL Sbjct: 359 NPPIYRETHVTEYMAYFRSKGLDGNSSLPHFKL 391 >gb|ABK96309.1| unknown [Populus trichocarpa x Populus deltoides] Length = 370 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 284 NPPIYKDILITEFFAFYKSKGLDGNSALPHFKL 186 NPPIY +I + +F A+Y SKGLDGNSALPHFKL Sbjct: 338 NPPIYCEITVKDFIAYYDSKGLDGNSALPHFKL 370 >ref|XP_002284676.2| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1 [Vitis vinifera] Length = 684 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 284 NPPIYKDILITEFFAFYKSKGLDGNSALPHFKL 186 NPPIY++ + EF A+Y SKGLDGNS+LPHFKL Sbjct: 341 NPPIYRETTVDEFLAYYFSKGLDGNSSLPHFKL 373 >emb|CBI23602.3| unnamed protein product [Vitis vinifera] Length = 207 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 284 NPPIYKDILITEFFAFYKSKGLDGNSALPHFKL 186 NPPIY++ + EF A+Y SKGLDGNS+LPHFKL Sbjct: 175 NPPIYRETTVDEFLAYYFSKGLDGNSSLPHFKL 207 >emb|CAN80594.1| hypothetical protein VITISV_017626 [Vitis vinifera] Length = 373 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 284 NPPIYKDILITEFFAFYKSKGLDGNSALPHFKL 186 NPPIY++ + EF A+Y SKGLDGNS+LPHFKL Sbjct: 341 NPPIYRETTVDEFLAYYFSKGLDGNSSLPHFKL 373 >ref|XP_002315711.2| hypothetical protein POPTR_0010s08380g [Populus trichocarpa] gi|550329369|gb|EEF01882.2| hypothetical protein POPTR_0010s08380g [Populus trichocarpa] Length = 370 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 284 NPPIYKDILITEFFAFYKSKGLDGNSALPHFKL 186 NPPIY +I + +F A+Y SKGLDGNSALPHFK+ Sbjct: 338 NPPIYCEITVKDFIAYYDSKGLDGNSALPHFKV 370