BLASTX nr result
ID: Akebia25_contig00015176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00015176 (610 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051510.1| Uncharacterized protein TCM_005116 [Theobrom... 62 1e-10 ref|XP_002301419.2| hypothetical protein POPTR_0002s17440g [Popu... 56 6e-09 ref|XP_006444809.1| hypothetical protein CICLE_v10022804mg [Citr... 51 9e-06 >ref|XP_007051510.1| Uncharacterized protein TCM_005116 [Theobroma cacao] gi|508703771|gb|EOX95667.1| Uncharacterized protein TCM_005116 [Theobroma cacao] Length = 88 Score = 62.0 bits (149), Expect(2) = 1e-10 Identities = 32/44 (72%), Positives = 33/44 (75%) Frame = -3 Query: 389 ASAFFASLERCSCINLSXXXXXXXXXAKDRPLMLTKSIVHDQPE 258 ASAFFASLERCSCINLS AKDRPLMLTK IVHD+ E Sbjct: 25 ASAFFASLERCSCINLSTTDFDDEEEAKDRPLMLTKPIVHDETE 68 Score = 30.0 bits (66), Expect(2) = 1e-10 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 435 DNCGFISCEKLDRM 394 + CGFISC+KLDRM Sbjct: 3 NGCGFISCDKLDRM 16 >ref|XP_002301419.2| hypothetical protein POPTR_0002s17440g [Populus trichocarpa] gi|550345221|gb|EEE80692.2| hypothetical protein POPTR_0002s17440g [Populus trichocarpa] Length = 96 Score = 56.2 bits (134), Expect(2) = 6e-09 Identities = 34/59 (57%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Frame = -3 Query: 389 ASAFFASLERCSCINLSXXXXXXXXXAKDRPLMLTKSIVHD-----QPE-NNDVEKLPV 231 ASAFFASLERCSCINL+ A+DRPLMLTK HD QP N+D KL V Sbjct: 38 ASAFFASLERCSCINLNTTDLEDDEEARDRPLMLTKPSAHDHHLDAQPTINSDAPKLSV 96 Score = 30.4 bits (67), Expect(2) = 6e-09 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 444 PKMDNCGFISCEKLDRM 394 P +NC F+SCEKLDR+ Sbjct: 13 PNNNNCNFMSCEKLDRV 29 >ref|XP_006444809.1| hypothetical protein CICLE_v10022804mg [Citrus clementina] gi|557547071|gb|ESR58049.1| hypothetical protein CICLE_v10022804mg [Citrus clementina] Length = 135 Score = 51.2 bits (121), Expect(2) = 9e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -3 Query: 389 ASAFFASLERCSCINLSXXXXXXXXXAKDRPLMLTKSIVH 270 A+AFFASLERCSCINLS AKDRPLM+ +S VH Sbjct: 75 ATAFFASLERCSCINLSTAEFEDEDEAKDRPLMVFRSTVH 114 Score = 24.6 bits (52), Expect(2) = 9e-06 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -2 Query: 429 CGFISCEKLDRM 394 C F+SC+KLDR+ Sbjct: 55 CSFMSCDKLDRV 66