BLASTX nr result
ID: Akebia25_contig00015041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00015041 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447115.1| hypothetical protein CICLE_v10015501mg [Citr... 60 4e-07 ref|XP_002535825.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_006447115.1| hypothetical protein CICLE_v10015501mg [Citrus clementina] gi|557549726|gb|ESR60355.1| hypothetical protein CICLE_v10015501mg [Citrus clementina] Length = 398 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/81 (44%), Positives = 51/81 (62%) Frame = +2 Query: 107 MFRFTIYQQLIRNRIRSSTTTFHVCFLKTQSLKKSNTNISNQESLTVSYLLNLCGLSLES 286 MFR I + L+ + + +V +++TQS S + +NQ+SLTVS+L N CGLSLE Sbjct: 1 MFRL-ICKTLVDKQRSVDLSINYVRYIQTQSSLSSISKPTNQQSLTVSFLTNSCGLSLEK 59 Query: 287 AILASKKIKIRSTEKSNSVLE 349 AI +K I I +T K NSVL+ Sbjct: 60 AISVAKVINIHNTVKPNSVLQ 80 >ref|XP_002535825.1| conserved hypothetical protein [Ricinus communis] gi|223521814|gb|EEF26558.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/60 (53%), Positives = 46/60 (76%), Gaps = 3/60 (5%) Frame = +2 Query: 179 CFLKT-QSLKKSNT-NIS-NQESLTVSYLLNLCGLSLESAILASKKIKIRSTEKSNSVLE 349 C+++ Q+L SN+ +IS +Q+SLTVSYL NLCGLSL+ A+ A+K +KI TEK + VL+ Sbjct: 20 CYIRCIQTLPSSNSASISKDQQSLTVSYLTNLCGLSLQKAVSATKYVKIERTEKPDMVLQ 79