BLASTX nr result
ID: Akebia25_contig00014985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00014985 (1164 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006830102.1| hypothetical protein AMTR_s05231p00006790, p... 89 4e-15 emb|CBI32203.3| unnamed protein product [Vitis vinifera] 60 2e-06 >ref|XP_006830102.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] gi|548835948|gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] Length = 77 Score = 89.0 bits (219), Expect = 4e-15 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = +1 Query: 847 CYCSKHITCIHALHIRLEFTPRNITIPTPSRQSHEPLIHSHSITAGDQV 993 C + ITCIHALHIRLEF PRNI IPTPSRQSHEPLIHSHSITAG+QV Sbjct: 7 CLSFQGITCIHALHIRLEFAPRNIAIPTPSRQSHEPLIHSHSITAGEQV 55 >emb|CBI32203.3| unnamed protein product [Vitis vinifera] Length = 83 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +3 Query: 864 HNLYPCTSYSPGVHS*KYNHPYPLTSIPR 950 HNLYPC SYSPGV S KY+HPYPLTSIPR Sbjct: 27 HNLYPCASYSPGVRSQKYSHPYPLTSIPR 55