BLASTX nr result
ID: Akebia25_contig00014763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00014763 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828277.1| hypothetical protein AMTR_s00023p00221340 [A... 156 2e-36 dbj|BAO57288.1| pseudo-response regulator [Ipomoea nil] 152 6e-35 ref|XP_007016630.1| Pseudo-response regulator 7, putative isofor... 151 1e-34 ref|XP_007016628.1| Pseudo-response regulator 7, putative isofor... 151 1e-34 ref|XP_007016627.1| Pseudo-response regulator 7, putative isofor... 151 1e-34 gb|ABV53463.1| pseudo-response regulator 7 [Castanea sativa] 151 1e-34 ref|XP_002275645.2| PREDICTED: two-component response regulator-... 150 1e-34 emb|CBI16234.3| unnamed protein product [Vitis vinifera] 150 1e-34 emb|CBI25329.3| unnamed protein product [Vitis vinifera] 150 1e-34 ref|XP_002281776.1| PREDICTED: two-component response regulator-... 150 1e-34 ref|XP_002531836.1| sensory transduction histidine kinase, putat... 150 1e-34 ref|XP_007009674.1| Pseudo response regulator isoform 11 [Theobr... 147 1e-33 ref|XP_007009672.1| Pseudo response regulator, putative isoform ... 147 1e-33 ref|XP_007009671.1| Pseudo response regulator, putative isoform ... 147 1e-33 ref|XP_007009670.1| Pseudo response regulator, putative isoform ... 147 1e-33 ref|XP_007009668.1| Pseudo response regulator, putative isoform ... 147 1e-33 ref|XP_007009667.1| Pseudo response regulator, putative isoform ... 147 1e-33 ref|XP_007009666.1| Pseudo response regulator isoform 3 [Theobro... 147 1e-33 ref|XP_007009665.1| Pseudo response regulator, putative isoform ... 147 1e-33 ref|XP_007009664.1| Pseudo response regulator, putative isoform ... 147 1e-33 >ref|XP_006828277.1| hypothetical protein AMTR_s00023p00221340 [Amborella trichopoda] gi|548832924|gb|ERM95693.1| hypothetical protein AMTR_s00023p00221340 [Amborella trichopoda] Length = 784 Score = 156 bits (395), Expect = 2e-36 Identities = 76/89 (85%), Positives = 82/89 (92%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTRQ+VSALL+NCSYEVT+ ANGLQAWK+L D +NHIDLVL Sbjct: 90 WERFLPLRSLKVLLVENDDSTRQVVSALLQNCSYEVTSAANGLQAWKVLEDLSNHIDLVL 149 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIMNHKT KNIPVI Sbjct: 150 TEVVMPYLSGIGLLSKIMNHKTCKNIPVI 178 >dbj|BAO57288.1| pseudo-response regulator [Ipomoea nil] Length = 787 Score = 152 bits (383), Expect = 6e-35 Identities = 72/89 (80%), Positives = 79/89 (88%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +VSALLRNCSYEVTAVANG +AWKIL D NHIDLVL Sbjct: 85 WERFLPLRSLKVLLVENDDSTRHVVSALLRNCSYEVTAVANGFEAWKILEDLTNHIDLVL 144 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+ P +SGIGLL K+MNHKT KN+P+I Sbjct: 145 TEVAMPYMSGIGLLSKVMNHKTRKNVPLI 173 >ref|XP_007016630.1| Pseudo-response regulator 7, putative isoform 4 [Theobroma cacao] gi|508786993|gb|EOY34249.1| Pseudo-response regulator 7, putative isoform 4 [Theobroma cacao] Length = 750 Score = 151 bits (381), Expect = 1e-34 Identities = 72/89 (80%), Positives = 80/89 (89%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLP+RSLKVLLVENDDSTR +VSALLRNCSYEVTAVAN LQAWK+L D NH+D+VL Sbjct: 64 WERFLPIRSLKVLLVENDDSTRHVVSALLRNCSYEVTAVANDLQAWKVLEDLTNHVDIVL 123 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+ P LSGIGLL KIM+HKT+KNIPVI Sbjct: 124 TEVAIPVLSGIGLLYKIMSHKTFKNIPVI 152 >ref|XP_007016628.1| Pseudo-response regulator 7, putative isoform 2 [Theobroma cacao] gi|508786991|gb|EOY34247.1| Pseudo-response regulator 7, putative isoform 2 [Theobroma cacao] Length = 741 Score = 151 bits (381), Expect = 1e-34 Identities = 72/89 (80%), Positives = 80/89 (89%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLP+RSLKVLLVENDDSTR +VSALLRNCSYEVTAVAN LQAWK+L D NH+D+VL Sbjct: 64 WERFLPIRSLKVLLVENDDSTRHVVSALLRNCSYEVTAVANDLQAWKVLEDLTNHVDIVL 123 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+ P LSGIGLL KIM+HKT+KNIPVI Sbjct: 124 TEVAIPVLSGIGLLYKIMSHKTFKNIPVI 152 >ref|XP_007016627.1| Pseudo-response regulator 7, putative isoform 1 [Theobroma cacao] gi|590590068|ref|XP_007016629.1| Pseudo-response regulator 7, putative isoform 1 [Theobroma cacao] gi|508786990|gb|EOY34246.1| Pseudo-response regulator 7, putative isoform 1 [Theobroma cacao] gi|508786992|gb|EOY34248.1| Pseudo-response regulator 7, putative isoform 1 [Theobroma cacao] Length = 765 Score = 151 bits (381), Expect = 1e-34 Identities = 72/89 (80%), Positives = 80/89 (89%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLP+RSLKVLLVENDDSTR +VSALLRNCSYEVTAVAN LQAWK+L D NH+D+VL Sbjct: 64 WERFLPIRSLKVLLVENDDSTRHVVSALLRNCSYEVTAVANDLQAWKVLEDLTNHVDIVL 123 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+ P LSGIGLL KIM+HKT+KNIPVI Sbjct: 124 TEVAIPVLSGIGLLYKIMSHKTFKNIPVI 152 >gb|ABV53463.1| pseudo-response regulator 7 [Castanea sativa] Length = 784 Score = 151 bits (381), Expect = 1e-34 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +VSALLRNC YEVTA NGLQAWKIL D+ H+DLVL Sbjct: 89 WERFLPLRSLKVLLVENDDSTRHVVSALLRNCGYEVTAAENGLQAWKILEDYTTHVDLVL 148 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT KNIPVI Sbjct: 149 TEVVMPCLSGIGLLSKIMSHKTCKNIPVI 177 >ref|XP_002275645.2| PREDICTED: two-component response regulator-like PRR73 [Vitis vinifera] Length = 747 Score = 150 bits (380), Expect = 1e-34 Identities = 74/89 (83%), Positives = 79/89 (88%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVEND+STRQ+VSALLRNCSYEVTAVANG+QAW IL D NH+DLVL Sbjct: 63 WERFLPLRSLKVLLVENDNSTRQVVSALLRNCSYEVTAVANGVQAWSILDDLTNHVDLVL 122 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 E+ PSLSGIGLL KIMNHK KNIPVI Sbjct: 123 AEVALPSLSGIGLLCKIMNHKACKNIPVI 151 >emb|CBI16234.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 150 bits (380), Expect = 1e-34 Identities = 72/89 (80%), Positives = 81/89 (91%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 W+ FLP+RSLKVLLVENDDSTR +V+ALLRNCSYEVTAVANGLQAWKIL D NHID+VL Sbjct: 86 WDSFLPIRSLKVLLVENDDSTRHVVTALLRNCSYEVTAVANGLQAWKILEDLTNHIDIVL 145 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P +SGIGLL KIM+HKT+KNIPVI Sbjct: 146 TEVVMPFISGIGLLCKIMSHKTFKNIPVI 174 >emb|CBI25329.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 150 bits (380), Expect = 1e-34 Identities = 74/89 (83%), Positives = 79/89 (88%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVEND+STRQ+VSALLRNCSYEVTAVANG+QAW IL D NH+DLVL Sbjct: 85 WERFLPLRSLKVLLVENDNSTRQVVSALLRNCSYEVTAVANGVQAWSILDDLTNHVDLVL 144 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 E+ PSLSGIGLL KIMNHK KNIPVI Sbjct: 145 AEVALPSLSGIGLLCKIMNHKACKNIPVI 173 >ref|XP_002281776.1| PREDICTED: two-component response regulator-like PRR73-like [Vitis vinifera] Length = 785 Score = 150 bits (380), Expect = 1e-34 Identities = 72/89 (80%), Positives = 81/89 (91%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 W+ FLP+RSLKVLLVENDDSTR +V+ALLRNCSYEVTAVANGLQAWKIL D NHID+VL Sbjct: 86 WDSFLPIRSLKVLLVENDDSTRHVVTALLRNCSYEVTAVANGLQAWKILEDLTNHIDIVL 145 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P +SGIGLL KIM+HKT+KNIPVI Sbjct: 146 TEVVMPFISGIGLLCKIMSHKTFKNIPVI 174 >ref|XP_002531836.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223528532|gb|EEF30556.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 807 Score = 150 bits (380), Expect = 1e-34 Identities = 74/89 (83%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLP+RSLKVLLVENDDSTR +VSALLRNCSYEV AVANG QAWKIL D NNH DLVL Sbjct: 65 WERFLPVRSLKVLLVENDDSTRHVVSALLRNCSYEVNAVANGFQAWKILEDMNNHTDLVL 124 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KI NHKT +NIPVI Sbjct: 125 TEVVMPILSGIGLLCKIRNHKTLRNIPVI 153 >ref|XP_007009674.1| Pseudo response regulator isoform 11 [Theobroma cacao] gi|508726587|gb|EOY18484.1| Pseudo response regulator isoform 11 [Theobroma cacao] Length = 579 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 88 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 147 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 148 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009672.1| Pseudo response regulator, putative isoform 9, partial [Theobroma cacao] gi|508726585|gb|EOY18482.1| Pseudo response regulator, putative isoform 9, partial [Theobroma cacao] Length = 769 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 72 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 131 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 132 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 160 >ref|XP_007009671.1| Pseudo response regulator, putative isoform 8, partial [Theobroma cacao] gi|508726584|gb|EOY18481.1| Pseudo response regulator, putative isoform 8, partial [Theobroma cacao] Length = 708 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 72 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 131 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 132 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 160 >ref|XP_007009670.1| Pseudo response regulator, putative isoform 7, partial [Theobroma cacao] gi|508726583|gb|EOY18480.1| Pseudo response regulator, putative isoform 7, partial [Theobroma cacao] Length = 709 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 72 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 131 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 132 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 160 >ref|XP_007009668.1| Pseudo response regulator, putative isoform 5 [Theobroma cacao] gi|508726581|gb|EOY18478.1| Pseudo response regulator, putative isoform 5 [Theobroma cacao] Length = 781 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 88 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 147 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 148 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009667.1| Pseudo response regulator, putative isoform 4 [Theobroma cacao] gi|508726580|gb|EOY18477.1| Pseudo response regulator, putative isoform 4 [Theobroma cacao] Length = 732 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 88 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 147 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 148 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009666.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|590564476|ref|XP_007009669.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|508726579|gb|EOY18476.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|508726582|gb|EOY18479.1| Pseudo response regulator isoform 3 [Theobroma cacao] Length = 792 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 88 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 147 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 148 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009665.1| Pseudo response regulator, putative isoform 2 [Theobroma cacao] gi|508726578|gb|EOY18475.1| Pseudo response regulator, putative isoform 2 [Theobroma cacao] Length = 782 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 88 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 147 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 148 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009664.1| Pseudo response regulator, putative isoform 1 [Theobroma cacao] gi|508726577|gb|EOY18474.1| Pseudo response regulator, putative isoform 1 [Theobroma cacao] Length = 799 Score = 147 bits (372), Expect = 1e-33 Identities = 73/89 (82%), Positives = 78/89 (87%) Frame = -1 Query: 268 WERFLPLRSLKVLLVENDDSTRQIVSALLRNCSYEVTAVANGLQAWKILHDWNNHIDLVL 89 WERFLPLRSLKVLLVENDDSTR +V ALLRNC +EVTAV+NGLQAWKIL D NHIDLVL Sbjct: 88 WERFLPLRSLKVLLVENDDSTRHVVCALLRNCGFEVTAVSNGLQAWKILEDLTNHIDLVL 147 Query: 88 TEIVTPSLSGIGLLGKIMNHKTYKNIPVI 2 TE+V P LSGIGLL KIM+HKT NIPVI Sbjct: 148 TEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176