BLASTX nr result
ID: Akebia25_contig00014752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00014752 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB83506.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus... 58 2e-06 ref|XP_006451205.1| hypothetical protein CICLE_v10007255mg [Citr... 53 2e-06 >gb|EXB83506.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis] Length = 1365 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -3 Query: 153 LLRCMKVDGKCRNIIAYMAELVPIL*CFMGANDGDMFKM--FVFSL 22 L++CM+ DG CRNIIA AEL P+L CFMGA+DG+ F++ F+F L Sbjct: 740 LVKCMQEDGMCRNIIADTAELAPVLECFMGASDGEKFEIARFLFEL 785 >ref|XP_006451205.1| hypothetical protein CICLE_v10007255mg [Citrus clementina] gi|557554431|gb|ESR64445.1| hypothetical protein CICLE_v10007255mg [Citrus clementina] Length = 1380 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -3 Query: 153 LLRCMKVDGKCRNIIAYMAELVPIL*CFMGANDGDMFKMFVF 28 LLRCM+ DGKCRN IA AEL P++ FM A+DG+ F++ F Sbjct: 755 LLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFEIVCF 796 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 37 VCFLSELDKLNK 2 VCFLSEL KLN+ Sbjct: 794 VCFLSELVKLNR 805