BLASTX nr result
ID: Akebia25_contig00014625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00014625 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETN41194.1| histone H3 [Cyphellophora europaea CBS 101466] 161 8e-38 emb|CCX13616.1| Similar to Histone H3; acc. no. P23753 [Pyronema... 161 8e-38 gb|AGO36700.1| histone, partial [Alternaria tenuissima] 161 8e-38 gb|AGO36691.1| histone, partial [Alternaria alternata] 161 8e-38 gb|AGO36686.1| histone, partial [Alternaria tenuissima] 161 8e-38 gb|AGO36685.1| histone, partial [Alternaria alternata] gi|514242... 161 8e-38 gb|AGO36683.1| histone, partial [Alternaria tenuissima] gi|51424... 161 8e-38 gb|AGO36681.1| histone, partial [Alternaria tenuissima] gi|51424... 161 8e-38 gb|AEY79838.1| histone H3, partial [Septoria sp. RHS70694] 161 8e-38 gb|AEY79829.1| histone H3, partial [Cercospora sp. RHS71404] gi|... 161 8e-38 gb|AAR98651.1| histone H3 [Cephalosporium gramineum] 161 8e-38 gb|AAO24304.1| histone [Lewia infectoria] 161 8e-38 gb|AAO24311.1| histone [Lewia infectoria] 161 8e-38 gb|AAO24266.1| histone [Alternaria arborescens] gi|27808204|gb|A... 161 8e-38 gb|AAX53008.1| histone H3 [Cercospora apii] gi|61695910|gb|AAX53... 161 8e-38 gb|AAW29630.1| histone H3, partial [Cercospora apii] gi|56787432... 161 8e-38 gb|AFV27389.1| histone H3, partial [Catenulostroma abietis] gi|4... 161 8e-38 gb|AFV27386.1| histone H3, partial [Teratosphaeria parva] gi|409... 161 8e-38 gb|AFV27378.1| histone H3, partial [Teratosphaeria nubilosa] 161 8e-38 gb|AFU72800.1| histone H3, partial [Cercospora sp. P JZG-2013] 161 8e-38 >gb|ETN41194.1| histone H3 [Cyphellophora europaea CBS 101466] Length = 310 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 24 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 83 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 84 RFQSSAIGALQESVEAYLVSLFE 106 >emb|CCX13616.1| Similar to Histone H3; acc. no. P23753 [Pyronema omphalodes CBS 100304] Length = 136 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 24 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 83 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 84 RFQSSAIGALQESVEAYLVSLFE 106 >gb|AGO36700.1| histone, partial [Alternaria tenuissima] Length = 105 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AGO36691.1| histone, partial [Alternaria alternata] Length = 122 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 17 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 76 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 77 RFQSSAIGALQESVEAYLVSLFE 99 >gb|AGO36686.1| histone, partial [Alternaria tenuissima] Length = 131 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AGO36685.1| histone, partial [Alternaria alternata] gi|514242888|gb|AGO36687.1| histone, partial [Alternaria alternata] gi|514242908|gb|AGO36697.1| histone, partial [Alternaria alternata] gi|514242922|gb|AGO36704.1| histone, partial [Alternaria alternata] Length = 105 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 17 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 76 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 77 RFQSSAIGALQESVEAYLVSLFE 99 >gb|AGO36683.1| histone, partial [Alternaria tenuissima] gi|514242882|gb|AGO36684.1| histone, partial [Alternaria tenuissima] gi|514242892|gb|AGO36689.1| histone, partial [Alternaria tenuissima] gi|514242894|gb|AGO36690.1| histone, partial [Alternaria tenuissima] gi|514242898|gb|AGO36692.1| histone, partial [Alternaria tenuissima] gi|514242902|gb|AGO36694.1| histone, partial [Alternaria tenuissima] gi|514242904|gb|AGO36695.1| histone, partial [Alternaria tenuissima] gi|514242906|gb|AGO36696.1| histone, partial [Alternaria tenuissima] gi|514242910|gb|AGO36698.1| histone, partial [Alternaria tenuissima] gi|514242912|gb|AGO36699.1| histone, partial [Alternaria tenuissima] gi|514242916|gb|AGO36701.1| histone, partial [Alternaria tenuissima] gi|514242918|gb|AGO36702.1| histone, partial [Alternaria tenuissima] gi|514242920|gb|AGO36703.1| histone, partial [Alternaria tenuissima] Length = 105 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AGO36681.1| histone, partial [Alternaria tenuissima] gi|514242878|gb|AGO36682.1| histone, partial [Alternaria tenuissima] Length = 105 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AEY79838.1| histone H3, partial [Septoria sp. RHS70694] Length = 116 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AEY79829.1| histone H3, partial [Cercospora sp. RHS71404] gi|373939862|gb|AEY79830.1| histone H3, partial [Cercospora sp. RHS88881] Length = 114 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 12 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 71 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 72 RFQSSAIGALQESVEAYLVSLFE 94 >gb|AAR98651.1| histone H3 [Cephalosporium gramineum] Length = 112 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AAO24304.1| histone [Lewia infectoria] Length = 119 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AAO24311.1| histone [Lewia infectoria] Length = 119 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AAO24266.1| histone [Alternaria arborescens] gi|27808204|gb|AAO24267.1| histone [Alternaria alternata s.l. STE-U4331] gi|27808206|gb|AAO24268.1| histone [Alternaria alternata s.l. STE-U4334] gi|27808208|gb|AAO24269.1| histone [Alternaria alternata s.l. STE-U4343] gi|27808210|gb|AAO24270.1| histone [Alternaria alternata s.l. STE-U4347] gi|27808212|gb|AAO24271.1| histone [Alternaria alternata s.l. STE-U4330] gi|27808214|gb|AAO24272.1| histone [Alternaria alternata s.l. STE-U4333] gi|27808216|gb|AAO24273.1| histone [Alternaria alternata s.l. STE-U4335] gi|27808218|gb|AAO24274.1| histone [Alternaria alternata s.l. STE-U4346] gi|27808220|gb|AAO24275.1| histone [Alternaria alternata s.l. STE-U4332] gi|27808222|gb|AAO24276.1| histone [Alternaria alternata s.l. STE-U4336] gi|27808224|gb|AAO24277.1| histone [Alternaria alternata s.l. STE-U4337] gi|27808226|gb|AAO24278.1| histone [Alternaria alternata s.l. STE-U4338] gi|27808228|gb|AAO24279.1| histone [Alternaria alternata s.l. STE-U4339] gi|27808230|gb|AAO24280.1| histone [Alternaria alternata s.l. STE-U4340] gi|27808232|gb|AAO24281.1| histone [Alternaria alternata s.l. STE-U4341] gi|27808234|gb|AAO24282.1| histone [Alternaria alternata s.l. STE-U4342] gi|27808236|gb|AAO24283.1| histone [Alternaria alternata s.l. STE-U4344] gi|27808238|gb|AAO24284.1| histone [Alternaria alternata s.l. STE-U4348] gi|27808240|gb|AAO24285.1| histone [Alternaria alternata s.l. STE-U4325] gi|27808242|gb|AAO24286.1| histone [Alternaria alternata s.l. STE-U4326] gi|27808244|gb|AAO24287.1| histone [Alternaria alternata s.l. STE-U4327] gi|27808246|gb|AAO24288.1| histone [Alternaria alternata s.l. STE-U4328] gi|27808248|gb|AAO24289.1| histone [Alternaria alternata s.l. STE-U4349] gi|27808250|gb|AAO24290.1| histone [Alternaria alternata s.l. STE-U4261] gi|27808252|gb|AAO24291.1| histone [Alternaria alternata s.l. STE-U4260] gi|27808254|gb|AAO24292.1| histone [Alternaria alternata s.l. STE-U4248] gi|27808256|gb|AAO24293.1| histone [Alternaria sp. STE-U4247] gi|27808258|gb|AAO24294.1| histone [Alternaria sp. STE-U4264] gi|27808260|gb|AAO24295.1| histone [Alternaria alternata s.l. STE-U4242] gi|27808262|gb|AAO24296.1| histone [Alternaria sp. STE-U4255] gi|27808264|gb|AAO24297.1| histone [Alternaria tenuissima] gi|27808266|gb|AAO24298.1| histone [Lewia infectoria] gi|27808268|gb|AAO24299.1| histone [Alternaria alternata s.l. STE-U4265] gi|27808270|gb|AAO24300.1| histone [Alternaria alternata s.l. STE-U4259] gi|27808272|gb|AAO24301.1| histone [Alternaria alternata s.l. STE-U4249] gi|27808274|gb|AAO24302.1| histone [Alternaria alternata s.l. STE-U4263] gi|27808276|gb|AAO24303.1| histone [Alternaria alternata s.l. STE-U4266] gi|27808280|gb|AAO24305.1| histone [Alternaria arborescens] gi|27808282|gb|AAO24306.1| histone [Lewia infectoria] gi|27808284|gb|AAO24307.1| histone [Alternaria alternata s.l. STE-U4262] gi|27808286|gb|AAO24308.1| histone [Alternaria tenuissima] gi|27808288|gb|AAO24309.1| histone [Alternaria tenuissima] gi|27808290|gb|AAO24310.1| histone [Alternaria arborescens] gi|27808294|gb|AAO24312.1| histone [Alternaria alternata s.l. STE-U4258] gi|27808296|gb|AAO24313.1| histone [Alternaria alternata s.l. STE-U4257] gi|27808298|gb|AAO24314.1| histone [Alternaria arborescens] gi|27808300|gb|AAO24315.1| histone [Alternaria alternata s.l. STE-U4267] gi|27808302|gb|AAO24316.1| histone [Lewia infectoria] gi|453073532|gb|AGG22604.1| histone, partial [Alternaria tenuissima] gi|453073534|gb|AGG22605.1| histone, partial [Alternaria tenuissima] Length = 119 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 14 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 73 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 74 RFQSSAIGALQESVEAYLVSLFE 96 >gb|AAX53008.1| histone H3 [Cercospora apii] gi|61695910|gb|AAX53009.1| histone H3 [Cercospora apii] gi|61695912|gb|AAX53010.1| histone H3 [Cercospora apii] gi|61695914|gb|AAX53011.1| histone H3 [Cercospora apii] gi|61695928|gb|AAX53018.1| histone H3 [Cercospora beticola] gi|61695930|gb|AAX53019.1| histone H3 [Cercospora beticola] gi|61695932|gb|AAX53020.1| histone H3 [Cercospora beticola] gi|61695934|gb|AAX53021.1| histone H3 [Cercospora beticola] gi|61695936|gb|AAX53022.1| histone H3 [Cercospora beticola] gi|61695938|gb|AAX53023.1| histone H3 [Cercospora beticola] gi|61695940|gb|AAX53024.1| histone H3 [Cercospora beticola] gi|61695942|gb|AAX53025.1| histone H3 [Cercospora beticola] gi|61695944|gb|AAX53026.1| histone H3 [Cercospora beticola] gi|61695946|gb|AAX53027.1| histone H3 [Cercospora beticola] gi|61695948|gb|AAX53028.1| histone H3 [Cercospora beticola] gi|61695950|gb|AAX53029.1| histone H3 [Cercospora beticola] gi|61695952|gb|AAX53030.1| histone H3 [Cercospora beticola] gi|61695954|gb|AAX53031.1| histone H3 [Cercospora beticola] gi|61695958|gb|AAX53033.1| histone H3 [Cercospora apiicola] gi|61695960|gb|AAX53034.1| histone H3 [Cercospora apiicola] gi|61695962|gb|AAX53035.1| histone H3 [Cercospora apiicola] gi|61695968|gb|AAX53038.1| histone H3 [Cercospora apiicola] gi|61695970|gb|AAX53039.1| histone H3 [Cercospora apiicola] gi|61695972|gb|AAX53040.1| histone H3 [Cercospora apiicola] gi|68271763|gb|AAY89199.1| histone H3 [Cercospora beticola] gi|68271765|gb|AAY89200.1| histone H3 [Cercospora beticola] gi|68271767|gb|AAY89201.1| histone H3 [Cercospora beticola] gi|68271769|gb|AAY89202.1| histone H3 [Cercospora beticola] gi|68271771|gb|AAY89203.1| histone H3 [Cercospora beticola] gi|68271773|gb|AAY89204.1| histone H3 [Cercospora beticola] gi|68271775|gb|AAY89205.1| histone H3 [Cercospora beticola] gi|68271777|gb|AAY89206.1| histone H3 [Cercospora beticola] gi|68271779|gb|AAY89207.1| histone H3 [Cercospora beticola] gi|81239313|gb|ABB60172.1| histone H3, partial [Cercospora apii] gi|81239315|gb|ABB60173.1| histone H3, partial [Cercospora cf. resedae CBS 257.67] gi|81239317|gb|ABB60174.1| histone H3, partial [Cercospora apii] gi|81239319|gb|ABB60175.1| histone H3, partial [Cercospora apii] gi|81239321|gb|ABB60176.1| histone H3, partial [Cercospora apii] gi|81239323|gb|ABB60177.1| histone H3, partial [Cercospora apii] gi|81239329|gb|ABB60180.1| histone H3, partial [Cercospora beticola] gi|81239331|gb|ABB60181.1| histone H3, partial [Cercospora beticola] gi|81239333|gb|ABB60182.1| histone H3, partial [Cercospora beticola] gi|81239337|gb|ABB60184.1| histone H3, partial [Cercospora beticola] gi|81239339|gb|ABB60185.1| histone H3, partial [Cercospora beticola] gi|81239345|gb|ABB60188.1| histone H3, partial [Cercospora beticola] gi|110628082|gb|ABG79510.1| histone H3 [Passalora sp. CBS 113375] gi|110628086|gb|ABG79512.1| histone H3 [Passalora sp. CBS 113380] gi|110628088|gb|ABG79513.1| histone H3 [Passalora sp. CBS 113381] gi|110628092|gb|ABG79515.1| histone H3 [Passalora sp. CBS 113611] gi|110628108|gb|ABG79523.1| histone H3 [Pseudocercospora sp. CBS 113366] gi|110628110|gb|ABG79524.1| histone H3 [Pseudocercospora sp. CBS 113367] gi|110628112|gb|ABG79525.1| histone H3 [Pseudocercospora sp. CBS 113368] gi|110628114|gb|ABG79526.1| histone H3 [Pseudocercospora sp. CBS 113369] gi|110628116|gb|ABG79527.1| histone H3 [Pseudocercospora sp. CBS 113370] gi|110628118|gb|ABG79528.1| histone H3 [Pseudocercospora sp. CBS 113372] gi|110628124|gb|ABG79531.1| histone H3 [Septoria sp. CBS 113373] gi|114147002|gb|ABI50384.1| histone H3, partial [Cercospora aff. canescens CBS 111133] gi|114147006|gb|ABI50386.1| histone H3, partial [Cercospora aff. canescens CPC 4408] gi|114147008|gb|ABI50387.1| histone H3, partial [Cercospora aff. canescens CPC 4409] gi|114147010|gb|ABI50388.1| histone H3, partial [Cercospora kikuchii] gi|114147012|gb|ABI50389.1| histone H3, partial [Cercospora kikuchii] gi|114147014|gb|ABI50390.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|114147016|gb|ABI50391.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|114147018|gb|ABI50392.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|114147020|gb|ABI50393.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|114147022|gb|ABI50394.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|114147026|gb|ABI50396.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|114147030|gb|ABI50398.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|114147032|gb|ABI50399.1| histone H3, partial [Cercospora cf. flagellaris CPC 4411] gi|114147034|gb|ABI50400.1| histone H3, partial [Cercospora cf. nicotianae CBS 131.32] gi|114147036|gb|ABI50401.1| histone H3, partial [Cercospora cf. nicotianae CBS 570.69] gi|114147046|gb|ABI50406.1| histone H3, partial [Cercospora rodmanii] gi|114147048|gb|ABI50407.1| histone H3, partial [Cercospora rodmanii] gi|114147050|gb|ABI50408.1| histone H3, partial [Cercospora rodmanii] gi|114147052|gb|ABI50409.1| histone H3, partial [Cercospora rodmanii] gi|408476427|gb|AFU72610.1| histone H3, partial [Cercospora achyranthis] gi|408476429|gb|AFU72611.1| histone H3, partial [Cercospora alchemillicola] gi|408476431|gb|AFU72612.1| histone H3, partial [Cercospora cf. alchemillicola CPC 5126] gi|408476433|gb|AFU72613.1| histone H3, partial [Cercospora cf. alchemillicola CPC 5127] gi|408476437|gb|AFU72615.1| histone H3, partial [Cercospora althaeina] gi|408476439|gb|AFU72616.1| histone H3, partial [Cercospora althaeina] gi|408476445|gb|AFU72619.1| histone H3, partial [Cercospora apii] gi|408476447|gb|AFU72620.1| histone H3, partial [Cercospora apii] gi|408476449|gb|AFU72621.1| histone H3, partial [Cercospora apii] gi|408476451|gb|AFU72622.1| histone H3, partial [Cercospora apii] gi|408476453|gb|AFU72623.1| histone H3, partial [Cercospora apii] gi|408476455|gb|AFU72624.1| histone H3, partial [Cercospora armoraciae] gi|408476457|gb|AFU72625.1| histone H3, partial [Cercospora armoraciae] gi|408476459|gb|AFU72626.1| histone H3, partial [Cercospora armoraciae] gi|408476461|gb|AFU72627.1| histone H3, partial [Cercospora armoraciae] gi|408476463|gb|AFU72628.1| histone H3, partial [Cercospora armoraciae] gi|408476469|gb|AFU72631.1| histone H3, partial [Cercospora armoraciae] gi|408476471|gb|AFU72632.1| histone H3, partial [Cercospora armoraciae] gi|408476473|gb|AFU72633.1| histone H3, partial [Cercospora armoraciae] gi|408476475|gb|AFU72634.1| histone H3, partial [Cercospora armoraciae] gi|408476477|gb|AFU72635.1| histone H3, partial [Cercospora armoraciae] gi|408476479|gb|AFU72636.1| histone H3, partial [Cercospora armoraciae] gi|408476481|gb|AFU72637.1| histone H3, partial [Cercospora armoraciae] gi|408476487|gb|AFU72640.1| histone H3, partial [Cercospora armoraciae] gi|408476493|gb|AFU72643.1| histone H3, partial [Cercospora beticola] gi|408476495|gb|AFU72644.1| histone H3, partial [Cercospora beticola] gi|408476499|gb|AFU72646.1| histone H3, partial [Cercospora cf. brunkii MUCC 732] gi|408476507|gb|AFU72650.1| histone H3, partial [Cercospora aff. canescens CBS 153.55] gi|408476509|gb|AFU72651.1| histone H3, partial [Cercospora aff. canescens CPC 11628] gi|408476513|gb|AFU72653.1| histone H3, partial [Cercospora aff. canescens CPC 15871] gi|408476521|gb|AFU72657.1| histone H3, partial [Cercospora capsici] gi|408476523|gb|AFU72658.1| histone H3, partial [Cercospora celosiae] gi|408476527|gb|AFU72660.1| histone H3, partial [Cercospora cf. chenopodii CBS 132594] gi|408476533|gb|AFU72663.1| histone H3, partial [Cercospora cf. chenopodii CPC 15763] gi|408476537|gb|AFU72665.1| histone H3, partial [Cercospora cf. chenopodii CPC 15862] gi|408476539|gb|AFU72666.1| histone H3, partial [Cercospora chinensis] gi|408476545|gb|AFU72669.1| histone H3, partial [Cercospora cf. citrulina MUCC 576] gi|408476547|gb|AFU72670.1| histone H3, partial [Cercospora cf. citrulina MUCC 577] gi|408476549|gb|AFU72671.1| histone H3, partial [Cercospora cf. citrulina MUCC 584] gi|408476551|gb|AFU72672.1| histone H3, partial [Cercospora cf. citrulina MUCC 588] gi|408476555|gb|AFU72674.1| histone H3, partial [Cercospora corchori] gi|408476557|gb|AFU72675.1| histone H3, partial [Cercospora cf. coreopsidis CBS 132598] gi|408476559|gb|AFU72676.1| histone H3, partial [Cercospora cf. coreopsidis CPC 10122] gi|408476561|gb|AFU72677.1| histone H3, partial [Cercospora delaireae] gi|408476563|gb|AFU72678.1| histone H3, partial [Cercospora delaireae] gi|408476565|gb|AFU72679.1| histone H3, partial [Cercospora delaireae] gi|408476567|gb|AFU72680.1| histone H3, partial [Cercospora delaireae] gi|408476571|gb|AFU72682.1| histone H3, partial [Cercospora cf. erysimi CBS 115059] gi|408476577|gb|AFU72685.1| histone H3, partial [Cercospora fagopyri] gi|408476579|gb|AFU72686.1| histone H3, partial [Cercospora fagopyri] gi|408476583|gb|AFU72688.1| histone H3, partial [Cercospora fagopyri] gi|408476585|gb|AFU72689.1| histone H3, partial [Cercospora fagopyri] gi|408476587|gb|AFU72690.1| histone H3, partial [Cercospora cf. flagellaris CBS 132637] gi|408476589|gb|AFU72691.1| histone H3, partial [Cercospora cf. flagellaris CBS 132646] gi|408476591|gb|AFU72692.1| histone H3, partial [Cercospora cf. flagellaris CBS 132648] gi|408476601|gb|AFU72697.1| histone H3, partial [Cercospora cf. flagellaris CBS 143.51] gi|408476603|gb|AFU72698.1| histone H3, partial [Cercospora cf. flagellaris CPC 10124] gi|408476605|gb|AFU72699.1| histone H3, partial [Cercospora cf. flagellaris CPC 1051] gi|408476607|gb|AFU72700.1| histone H3, partial [Cercospora cf. flagellaris CPC 1052] gi|408476609|gb|AFU72701.1| histone H3, partial [Cercospora cf. flagellaris CPC 10684] gi|408476611|gb|AFU72702.1| histone H3, partial [Cercospora cf. flagellaris CPC 5441] gi|408476613|gb|AFU72703.1| histone H3, partial [Cercospora cf. flagellaris MUCC 127] gi|408476615|gb|AFU72704.1| histone H3, partial [Cercospora cf. flagellaris MUCC 735] gi|408476619|gb|AFU72706.1| histone H3, partial [Cercospora cf. helianthicola MUCC 716] gi|408476621|gb|AFU72707.1| histone H3, partial [Cercospora cf. ipomoeae CBS 132639] gi|408476623|gb|AFU72708.1| histone H3, partial [Cercospora cf. ipomoeae CBS 132652] gi|408476625|gb|AFU72709.1| histone H3, partial [Cercospora cf. ipomoeae MUCC 442] gi|408476629|gb|AFU72711.1| histone H3, partial [Cercospora kikuchii] gi|408476631|gb|AFU72712.1| histone H3, partial [Cercospora lactucae-sativae] gi|408476633|gb|AFU72713.1| histone H3, partial [Cercospora lactucae-sativae] gi|408476639|gb|AFU72716.1| histone H3, partial [Cercospora cf. malloti MUCC 575] gi|408476641|gb|AFU72717.1| histone H3, partial [Cercospora cf. malloti MUCC 787] gi|408476649|gb|AFU72721.1| histone H3, partial [Cercospora cf. modiolae CPC 5115] gi|408476651|gb|AFU72722.1| histone H3, partial [Cercospora cf. nicotianae CBS 132632] gi|408476653|gb|AFU72723.1| histone H3, partial [Cercospora olivascens] gi|408476657|gb|AFU72725.1| histone H3, partial [Cercospora pileicola] gi|408476659|gb|AFU72726.1| histone H3, partial [Cercospora pileicola] gi|408476671|gb|AFU72732.1| histone H3, partial [Cercospora cf. richardiicola MUCC 128] gi|408476673|gb|AFU72733.1| histone H3, partial [Cercospora cf. richardiicola MUCC 132] gi|408476675|gb|AFU72734.1| histone H3, partial [Cercospora cf. richardiicola MUCC 138] gi|408476677|gb|AFU72735.1| histone H3, partial [Cercospora cf. richardiicola MUCC 578] gi|408476679|gb|AFU72736.1| histone H3, partial [Cercospora cf. richardiicola MUCC 582] gi|408476681|gb|AFU72737.1| histone H3, partial [Cercospora ricinella] gi|408476683|gb|AFU72738.1| histone H3, partial [Cercospora ricinella] gi|408476685|gb|AFU72739.1| histone H3, partial [Cercospora rumicis] gi|408476689|gb|AFU72741.1| histone H3, partial [Cercospora cf. sigesbeckiae CBS 132601] gi|408476695|gb|AFU72744.1| histone H3, partial [Cercospora cf. sigesbeckiae CBS 132641] gi|408476697|gb|AFU72745.1| histone H3, partial [Cercospora cf. sigesbeckiae CBS 132642] gi|408476701|gb|AFU72747.1| histone H3, partial [Cercospora cf. sigesbeckiae MUCC 587] gi|408476703|gb|AFU72748.1| histone H3, partial [Cercospora cf. sigesbeckiae MUCC 589] gi|408476705|gb|AFU72749.1| histone H3, partial [Cercospora cf. sigesbeckiae MUCC 849] gi|408476743|gb|AFU72768.1| histone H3, partial [Cercospora sp. B JZG-2013] gi|408476747|gb|AFU72770.1| histone H3, partial [Cercospora sp. D JZG-2013] gi|408476749|gb|AFU72771.1| histone H3, partial [Cercospora sp. E JZG-2013] gi|408476753|gb|AFU72773.1| histone H3, partial [Cercospora sp. G JZG-2013] gi|408476755|gb|AFU72774.1| histone H3, partial [Cercospora sp. G JZG-2013] gi|408476757|gb|AFU72775.1| histone H3, partial [Cercospora sp. H JZG-2013] gi|408476761|gb|AFU72777.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476765|gb|AFU72779.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476767|gb|AFU72780.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476769|gb|AFU72781.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476771|gb|AFU72782.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476773|gb|AFU72783.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476775|gb|AFU72784.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476777|gb|AFU72785.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476779|gb|AFU72786.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476783|gb|AFU72788.1| histone H3, partial [Cercospora sp. K JZG-2013] gi|408476785|gb|AFU72789.1| histone H3, partial [Cercospora sp. K JZG-2013] gi|408476795|gb|AFU72794.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476797|gb|AFU72795.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476799|gb|AFU72796.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476801|gb|AFU72797.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476803|gb|AFU72798.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476805|gb|AFU72799.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476809|gb|AFU72801.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476811|gb|AFU72802.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476813|gb|AFU72803.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476815|gb|AFU72804.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476817|gb|AFU72805.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476819|gb|AFU72806.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476821|gb|AFU72807.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|408476823|gb|AFU72808.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476825|gb|AFU72809.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476827|gb|AFU72810.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476829|gb|AFU72811.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476831|gb|AFU72812.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476833|gb|AFU72813.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476837|gb|AFU72815.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476839|gb|AFU72816.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476845|gb|AFU72819.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476855|gb|AFU72824.1| histone H3, partial [Cercospora sp. S JZG-2013] gi|408476857|gb|AFU72825.1| histone H3, partial [Cercospora vignigena] gi|408476861|gb|AFU72827.1| histone H3, partial [Cercospora vignigena] gi|408476863|gb|AFU72828.1| histone H3, partial [Cercospora violae] gi|408476865|gb|AFU72829.1| histone H3, partial [Cercospora violae] gi|408476867|gb|AFU72830.1| histone H3, partial [Cercospora violae] gi|408476869|gb|AFU72831.1| histone H3, partial [Cercospora violae] gi|408476871|gb|AFU72832.1| histone H3, partial [Cercospora violae] gi|408476877|gb|AFU72835.1| histone H3, partial [Cercospora zebrina] gi|408476879|gb|AFU72836.1| histone H3, partial [Cercospora zebrina] gi|408476883|gb|AFU72838.1| histone H3, partial [Cercospora zebrina] gi|408476885|gb|AFU72839.1| histone H3, partial [Cercospora zebrina] gi|408476895|gb|AFU72844.1| histone H3, partial [Cercospora zebrina] gi|408476897|gb|AFU72845.1| histone H3, partial [Cercospora zebrina] gi|408476899|gb|AFU72846.1| histone H3, partial [Cercospora zebrina] gi|408476901|gb|AFU72847.1| histone H3, partial [Cercospora zebrina] gi|408476905|gb|AFU72849.1| histone H3, partial [Cercospora zebrina] gi|408476911|gb|AFU72852.1| histone H3, partial [Cercospora cf. zinniae MUCC 131] gi|408476913|gb|AFU72853.1| histone H3, partial [Cercospora cf. zinniae MUCC 572] Length = 107 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 12 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 71 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 72 RFQSSAIGALQESVEAYLVSLFE 94 >gb|AAW29630.1| histone H3, partial [Cercospora apii] gi|56787432|gb|AAW29631.1| histone H3, partial [Cercospora beticola] gi|56787434|gb|AAW29632.1| histone H3, partial [Cercospora beticola] gi|56787436|gb|AAW29633.1| histone H3, partial [Cercospora beticola] gi|56787438|gb|AAW29634.1| histone H3, partial [Cercospora beticola] gi|56787440|gb|AAW29635.1| histone H3, partial [Cercospora beticola] gi|56787442|gb|AAW29636.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|56787444|gb|AAW29637.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|56787446|gb|AAW29638.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|56787448|gb|AAW29639.1| histone H3, partial [Cercospora sp. M JZG-2013] gi|56787450|gb|AAW29640.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|56787452|gb|AAW29641.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|56787456|gb|AAW29643.1| histone H3, partial [Zasmidium citri] gi|56787458|gb|AAW29644.1| histone H3, partial [Zasmidium citri] gi|56787460|gb|AAW29645.1| histone H3, partial [Pseudocercospora colombiensis] gi|56787462|gb|AAW29646.1| histone H3, partial [Pseudocercospora colombiensis] gi|56787464|gb|AAW29647.1| histone H3, partial [Pseudocercospora colombiensis] gi|56787466|gb|AAW29648.1| histone H3, partial [Pallidocercospora konae] gi|56787468|gb|AAW29649.1| histone H3, partial [Pallidocercospora konae] gi|56787470|gb|AAW29650.1| histone H3, partial [Mycosphaerella sp. CPC 10516] gi|56787472|gb|AAW29651.1| histone H3, partial [Mycosphaerella sp. CPC 10518] gi|56787474|gb|AAW29652.1| histone H3, partial [Mycosphaerella sp. CPC 10524] gi|56787476|gb|AAW29653.1| histone H3, partial [Pseudocercospora thailandica] gi|56787478|gb|AAW29654.1| histone H3, partial [Pseudocercospora thailandica] gi|56787480|gb|AAW29655.1| histone H3, partial [Pseudocercospora thailandica] gi|56787482|gb|AAW29656.1| histone H3, partial [Pseudocercospora thailandica] gi|56787484|gb|AAW29657.1| histone H3, partial [Pseudocercospora thailandica] gi|56787486|gb|AAW29658.1| histone H3, partial [Pseudocercospora thailandica] gi|61695916|gb|AAX53012.1| histone H3 [Cercospora apii] gi|61695918|gb|AAX53013.1| histone H3 [Cercospora apii] gi|61695920|gb|AAX53014.1| histone H3 [Cercospora apii] gi|61695922|gb|AAX53015.1| histone H3 [Cercospora apii] gi|61695924|gb|AAX53016.1| histone H3 [Cercospora apii] gi|61695926|gb|AAX53017.1| histone H3 [Cercospora apii] gi|61695956|gb|AAX53032.1| histone H3 [Cercospora apiicola] gi|61695964|gb|AAX53036.1| histone H3 [Cercospora apiicola] gi|61695966|gb|AAX53037.1| histone H3 [Cercospora apiicola] gi|77540124|gb|ABA86926.1| histone H3, partial [Cercospora sp. F JZG-2013] gi|77540126|gb|ABA86927.1| histone H3, partial [Cercospora zeae-maydis] gi|77540128|gb|ABA86928.1| histone H3, partial [Cercospora zeae-maydis] gi|77540130|gb|ABA86929.1| histone H3, partial [Cercospora zeae-maydis] gi|77540132|gb|ABA86930.1| histone H3, partial [Cercospora zeae-maydis] gi|77540134|gb|ABA86931.1| histone H3, partial [Cercospora zeae-maydis] gi|77540136|gb|ABA86932.1| histone H3, partial [Cercospora zeae-maydis] gi|77540138|gb|ABA86933.1| histone H3, partial [Cercospora zeae-maydis] gi|77540140|gb|ABA86934.1| histone H3, partial [Cercospora zeae-maydis] gi|77540142|gb|ABA86935.1| histone H3, partial [Cercospora zeae-maydis] gi|77540144|gb|ABA86936.1| histone H3, partial [Cercospora zeina] gi|81239325|gb|ABB60178.1| histone H3, partial [Cercospora beticola] gi|81239327|gb|ABB60179.1| histone H3, partial [Cercospora beticola] gi|81239335|gb|ABB60183.1| histone H3, partial [Cercospora beticola] gi|81239341|gb|ABB60186.1| histone H3, partial [Cercospora beticola] gi|81239343|gb|ABB60187.1| histone H3, partial [Cercospora beticola] gi|81239347|gb|ABB60189.1| histone H3, partial [Cercospora beticola] gi|81239349|gb|ABB60190.1| histone H3, partial [Cercospora beticola] gi|81239351|gb|ABB60191.1| histone H3, partial [Cercospora beticola] gi|81239353|gb|ABB60192.1| histone H3, partial [Cercospora apiicola] gi|110628102|gb|ABG79520.1| histone H3 [Passalora sp. CBS 113383] gi|114147004|gb|ABI50385.1| histone H3, partial [Cercospora aff. canescens CBS 111134] gi|114147024|gb|ABI50395.1| histone H3, partial [Cercospora cf. flagellaris CBS 115482] gi|114147028|gb|ABI50397.1| histone H3, partial [Cercospora sp. P JZG-2013] gi|114147038|gb|ABI50402.1| histone H3, partial [Cercospora cf. flagellaris CBS 113127] gi|114147040|gb|ABI50403.1| histone H3, partial [Cercospora rodmanii] gi|114147044|gb|ABI50405.1| histone H3, partial [Cercospora rodmanii] gi|229562443|gb|ACQ78198.1| histone H3 [Cercospora beticola] gi|229562445|gb|ACQ78199.1| histone H3 [Cercospora beticola] gi|229562447|gb|ACQ78200.1| histone H3 [Cercospora beticola] gi|229562449|gb|ACQ78201.1| histone H3 [Cercospora beticola] gi|229562451|gb|ACQ78202.1| histone H3 [Cercospora beticola] gi|373939866|gb|AEY79832.1| histone H3, partial [Septoria sp. RHS77656] gi|408476425|gb|AFU72609.1| histone H3, partial [Cercospora achyranthis] gi|408476435|gb|AFU72614.1| histone H3, partial [Cercospora althaeina] gi|408476465|gb|AFU72629.1| histone H3, partial [Cercospora armoraciae] gi|408476467|gb|AFU72630.1| histone H3, partial [Cercospora armoraciae] gi|408476483|gb|AFU72638.1| histone H3, partial [Cercospora armoraciae] gi|408476497|gb|AFU72645.1| histone H3, partial [Cercospora cf. brunkii CBS 132657] gi|408476501|gb|AFU72647.1| histone H3, partial [Cercospora campi-silii] gi|408476503|gb|AFU72648.1| histone H3, partial [Cercospora aff. canescens CBS 132658] gi|408476505|gb|AFU72649.1| histone H3, partial [Cercospora aff. canescens CBS 132659] gi|408476511|gb|AFU72652.1| histone H3, partial [Cercospora aff. canescens CPC 11640] gi|408476517|gb|AFU72655.1| histone H3, partial [Cercospora capsici] gi|408476519|gb|AFU72656.1| histone H3, partial [Cercospora capsici] gi|408476525|gb|AFU72659.1| histone H3, partial [Cercospora chenopodii] gi|408476573|gb|AFU72683.1| histone H3, partial [Cercospora euphorbiae-sieboldianae] gi|408476575|gb|AFU72684.1| histone H3, partial [Cercospora fagopyri] gi|408476581|gb|AFU72687.1| histone H3, partial [Cercospora fagopyri] gi|408476593|gb|AFU72693.1| histone H3, partial [Cercospora cf. flagellaris CBS 132653] gi|408476595|gb|AFU72694.1| histone H3, partial [Cercospora cf. flagellaris CBS 132667] gi|408476597|gb|AFU72695.1| histone H3, partial [Cercospora cf. flagellaris CBS 132670] gi|408476643|gb|AFU72718.1| histone H3, partial [Cercospora mercurialis] gi|408476645|gb|AFU72719.1| histone H3, partial [Cercospora mercurialis] gi|408476647|gb|AFU72720.1| histone H3, partial [Cercospora mercurialis] gi|408476655|gb|AFU72724.1| histone H3, partial [Cercospora cf. physalidis CBS 765.79] gi|408476661|gb|AFU72727.1| histone H3, partial [Cercospora pileicola] gi|408476663|gb|AFU72728.1| histone H3, partial [Cercospora polygonacea] gi|408476665|gb|AFU72729.1| histone H3, partial [Cercospora punctiformis] gi|408476691|gb|AFU72742.1| histone H3, partial [Cercospora cf. sigesbeckiae CBS 132606] gi|408476693|gb|AFU72743.1| histone H3, partial [Cercospora cf. sigesbeckiae CBS 132621] gi|408476699|gb|AFU72746.1| histone H3, partial [Cercospora cf. sigesbeckiae CBS 132675] gi|408476707|gb|AFU72750.1| histone H3, partial [Cercospora sojina] gi|408476709|gb|AFU72751.1| histone H3, partial [Cercospora sojina] gi|408476713|gb|AFU72753.1| histone H3, partial [Cercospora sojina] gi|408476759|gb|AFU72776.1| histone H3, partial [Cercospora sp. H JZG-2013] gi|408476763|gb|AFU72778.1| histone H3, partial [Cercospora sp. I JZG-2013] gi|408476781|gb|AFU72787.1| histone H3, partial [Cercospora sp. J JZG-2013] gi|408476787|gb|AFU72790.1| histone H3, partial [Cercospora sp. K JZG-2013] gi|408476835|gb|AFU72814.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476849|gb|AFU72821.1| histone H3, partial [Cercospora sp. Q JZG-2013] gi|408476853|gb|AFU72823.1| histone H3, partial [Cercospora sp. R JZG-2013] gi|408476859|gb|AFU72826.1| histone H3, partial [Cercospora vignigena] gi|408476873|gb|AFU72833.1| histone H3, partial [Cercospora zeae-maydis] gi|408476881|gb|AFU72837.1| histone H3, partial [Cercospora zebrina] gi|408476887|gb|AFU72840.1| histone H3, partial [Cercospora zebrina] gi|408476889|gb|AFU72841.1| histone H3, partial [Cercospora zebrina] gi|408476891|gb|AFU72842.1| histone H3, partial [Cercospora zebrina] gi|408476893|gb|AFU72843.1| histone H3, partial [Cercospora zebrina] gi|408476903|gb|AFU72848.1| histone H3, partial [Cercospora zebrina] gi|408476907|gb|AFU72850.1| histone H3, partial [Cercospora cf. zinniae CBS 132624] gi|408476915|gb|AFU72854.1| histone H3, partial [Septoria provencialis] Length = 110 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 12 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 71 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 72 RFQSSAIGALQESVEAYLVSLFE 94 >gb|AFV27389.1| histone H3, partial [Catenulostroma abietis] gi|409183781|gb|AFV27390.1| histone H3, partial [Catenulostroma abietis] gi|409183783|gb|AFV27391.1| histone H3, partial [Catenulostroma abietis] Length = 113 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 13 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 72 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 73 RFQSSAIGALQESVEAYLVSLFE 95 >gb|AFV27386.1| histone H3, partial [Teratosphaeria parva] gi|409183797|gb|AFV27398.1| histone H3, partial [Mycosphaerella marksii] gi|409183799|gb|AFV27399.1| histone H3, partial [Mycosphaerella marksii] Length = 116 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 13 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 72 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 73 RFQSSAIGALQESVEAYLVSLFE 95 >gb|AFV27378.1| histone H3, partial [Teratosphaeria nubilosa] Length = 111 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 13 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 72 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 73 RFQSSAIGALQESVEAYLVSLFE 95 >gb|AFU72800.1| histone H3, partial [Cercospora sp. P JZG-2013] Length = 103 Score = 161 bits (408), Expect = 8e-38 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = +3 Query: 3 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 182 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL Sbjct: 4 KAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDL 63 Query: 183 RFQSSAIGALQESVEAYLVSLFE 251 RFQSSAIGALQESVEAYLVSLFE Sbjct: 64 RFQSSAIGALQESVEAYLVSLFE 86