BLASTX nr result
ID: Akebia25_contig00014147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00014147 (584 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634663.1| PREDICTED: uncharacterized protein LOC100854... 57 5e-06 gb|EYU45031.1| hypothetical protein MIMGU_mgv1a017619mg [Mimulus... 56 8e-06 >ref|XP_003634663.1| PREDICTED: uncharacterized protein LOC100854863 [Vitis vinifera] gi|302142887|emb|CBI20182.3| unnamed protein product [Vitis vinifera] Length = 58 Score = 56.6 bits (135), Expect = 5e-06 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = +1 Query: 148 MAGEE---VGSVLVRLFAFIGAGVICTTSINLWRDLERKSAQRTAEAVIPEKQLGNM 309 M GEE G ++R+ F+GAG ICT +IN WRDL+RKSAQ+ A+ +PEK N+ Sbjct: 1 MIGEEGGPAGPKVLRMLYFVGAGFICTAAINKWRDLQRKSAQQHADQ-LPEKPANNL 56 >gb|EYU45031.1| hypothetical protein MIMGU_mgv1a017619mg [Mimulus guttatus] Length = 62 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = +1 Query: 151 AGEEVGSVLVRLFAFIGAGVICTTSINLWRDLERKSAQRTAEAVIPEKQLGN 306 AGEEV LVRL F+GAGVICT +IN W++LERK+ + E + + L N Sbjct: 6 AGEEVAPKLVRLLYFVGAGVICTAAINKWKELERKALIQKEEQQLNQPPLDN 57