BLASTX nr result
ID: Akebia25_contig00014137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00014137 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857660.1| hypothetical protein AMTR_s00061p00152710 [A... 59 9e-07 >ref|XP_006857660.1| hypothetical protein AMTR_s00061p00152710 [Amborella trichopoda] gi|548861756|gb|ERN19127.1| hypothetical protein AMTR_s00061p00152710 [Amborella trichopoda] Length = 838 Score = 58.5 bits (140), Expect = 9e-07 Identities = 35/91 (38%), Positives = 52/91 (57%) Frame = -1 Query: 316 LSTSPLHLEKLELEGFFKKGGRLPQWVCSLKCLKKCTVVNNKLMEDPISNFAQLPTLEIL 137 + ++P HL +L + G+LPQW+CSLK +KK ++V++ L EDP+ LP L L Sbjct: 662 MPSAPPHLSQLWIHAAL---GKLPQWMCSLKSIKKLSLVSSTLTEDPLVALQSLPNLAEL 718 Query: 136 MLHIKVYMGRKIDWVGTKNGENLSFPKLKYL 44 +L K Y G+K+ G FPKL +L Sbjct: 719 LLS-KAYNGKKMGSDGI-----YGFPKLTHL 743