BLASTX nr result
ID: Akebia25_contig00014010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00014010 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364060.1| PREDICTED: probable xyloglucan endotransgluc... 92 1e-16 ref|XP_004228752.1| PREDICTED: probable xyloglucan endotransgluc... 92 1e-16 ref|XP_007222502.1| hypothetical protein PRUPE_ppa008275mg [Prun... 85 1e-14 gb|ACD03223.1| xyloglucan endotransglucosylase/hydrolase 13 [Act... 85 1e-14 ref|XP_002527547.1| Xyloglucan endotransglucosylase/hydrolase pr... 85 1e-14 ref|XP_004297402.1| PREDICTED: probable xyloglucan endotransgluc... 84 2e-14 gb|ADE42491.1| xyloglucan endotransglucosylase/hydrolase 2 [Frag... 84 2e-14 gb|ADE42489.1| xyloglucan endotransglucosylase/hydrolase 2 [Frag... 84 2e-14 gb|EXC05043.1| putative xyloglucan endotransglucosylase/hydrolas... 84 3e-14 gb|AFK43337.1| unknown [Lotus japonicus] 84 3e-14 ref|XP_002311545.1| xyloglucan endotransglycosylase family prote... 83 3e-14 gb|ABK92940.1| unknown [Populus trichocarpa] 83 3e-14 emb|CAN74084.1| hypothetical protein VITISV_018042 [Vitis vinifera] 83 3e-14 gb|ABM91072.1| xyloglucan endotransglycosylase/hydrolase precurs... 83 3e-14 ref|XP_006469297.1| PREDICTED: probable xyloglucan endotransgluc... 83 4e-14 ref|XP_006448095.1| hypothetical protein CICLE_v10015872mg [Citr... 83 4e-14 gb|ACD03234.1| xyloglucan endotransglucosylase/hydrolase 10 [Mal... 82 8e-14 ref|XP_007153190.1| hypothetical protein PHAVU_003G014400g [Phas... 82 1e-13 gb|AGZ15408.1| xyloglucan endotransglucosylase/hydrolase protein... 82 1e-13 gb|AGV54504.1| xyloglucan endotransglucosylase/hydrolase protein... 82 1e-13 >ref|XP_006364060.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28-like [Solanum tuberosum] Length = 334 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP LAFDEGYSHLFGD+NL+ILKDGK+VH+SLD++TGAGFVSQDLY H Sbjct: 25 NLPILAFDEGYSHLFGDNNLMILKDGKSVHISLDKRTGAGFVSQDLYFH 73 >ref|XP_004228752.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28-like [Solanum lycopersicum] Length = 335 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP LAFDEGYSHLFGD+NL+ILKDGK+VH+SLD++TGAGFVSQDLY H Sbjct: 25 NLPILAFDEGYSHLFGDNNLMILKDGKSVHISLDKRTGAGFVSQDLYFH 73 >ref|XP_007222502.1| hypothetical protein PRUPE_ppa008275mg [Prunus persica] gi|462419438|gb|EMJ23701.1| hypothetical protein PRUPE_ppa008275mg [Prunus persica] Length = 338 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP ++FDEGY+ LFGDDNL+IL+DGK+VHLSLD++TG+GFVSQDLY H Sbjct: 28 NLPIISFDEGYNKLFGDDNLMILRDGKSVHLSLDERTGSGFVSQDLYHH 76 >gb|ACD03223.1| xyloglucan endotransglucosylase/hydrolase 13 [Actinidia deliciosa] Length = 329 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/49 (73%), Positives = 46/49 (93%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP ++FDEGYS LFGD+NL++L+DGK+VHLSLD++TG+GFVS DLYLH Sbjct: 23 NLPIISFDEGYSQLFGDENLMVLEDGKSVHLSLDERTGSGFVSHDLYLH 71 >ref|XP_002527547.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, putative [Ricinus communis] gi|223533097|gb|EEF34856.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, putative [Ricinus communis] Length = 338 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/59 (64%), Positives = 49/59 (83%) Frame = -1 Query: 178 ATSINPKRNLNLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 A S++ + LP + FDEGY+HLFGDDNL+I KDGKTV+L L+++TG+GFVSQDLYLH Sbjct: 22 AVSVSGSQTTTLPIIPFDEGYAHLFGDDNLVIHKDGKTVYLLLNERTGSGFVSQDLYLH 80 >ref|XP_004297402.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28-like isoform 2 [Fragaria vesca subsp. vesca] Length = 330 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = -1 Query: 145 LPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 LP ++FDEGY+ LFGDDNL+ILKDGK+VHL+LD++TG+GFVSQDLY+H Sbjct: 22 LPIMSFDEGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIH 69 >gb|ADE42491.1| xyloglucan endotransglucosylase/hydrolase 2 [Fragaria x ananassa] Length = 269 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = -1 Query: 145 LPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 LP ++FDEGY+ LFGDDNL+ILKDGK+VHL+LD++TG+GFVSQDLY+H Sbjct: 1 LPIMSFDEGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIH 48 >gb|ADE42489.1| xyloglucan endotransglucosylase/hydrolase 2 [Fragaria chiloensis] Length = 324 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = -1 Query: 145 LPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 LP ++FDEGY+ LFGDDNL+ILKDGK+VHL+LD++TG+GFVSQDLY+H Sbjct: 22 LPIMSFDEGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIH 69 >gb|EXC05043.1| putative xyloglucan endotransglucosylase/hydrolase protein 27 [Morus notabilis] Length = 340 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 +LP +AFDEGY+ LFGDDNLLI +DGKTVHL+L+++TG+GFVSQDLYLH Sbjct: 34 DLPIIAFDEGYTQLFGDDNLLIHRDGKTVHLTLNERTGSGFVSQDLYLH 82 >gb|AFK43337.1| unknown [Lotus japonicus] Length = 292 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/49 (73%), Positives = 46/49 (93%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP +AF+EGY+HLFGD+NL+I +DGK+VHLSLD++TG+GFVS DLYLH Sbjct: 25 NLPIIAFEEGYTHLFGDNNLIIHEDGKSVHLSLDERTGSGFVSHDLYLH 73 >ref|XP_002311545.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa] gi|222851365|gb|EEE88912.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa] Length = 336 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -1 Query: 145 LPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 LP ++FDEGY+ LFGDDNL I +DGKTVHLSLD++TG+GFVSQDLYLH Sbjct: 31 LPVISFDEGYTQLFGDDNLAIHRDGKTVHLSLDERTGSGFVSQDLYLH 78 >gb|ABK92940.1| unknown [Populus trichocarpa] Length = 336 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -1 Query: 145 LPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 LP ++FDEGY+ LFGDDNL I +DGKTVHLSLD++TG+GFVSQDLYLH Sbjct: 31 LPVISFDEGYTQLFGDDNLAIHRDGKTVHLSLDERTGSGFVSQDLYLH 78 >emb|CAN74084.1| hypothetical protein VITISV_018042 [Vitis vinifera] Length = 332 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -1 Query: 145 LPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 LP ++FDEGYS LFGD NL ILKDGKTVH+SLD++TG+GF+SQDLYLH Sbjct: 25 LPIISFDEGYSPLFGDANLAILKDGKTVHMSLDERTGSGFISQDLYLH 72 >gb|ABM91072.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-39 [Populus tremula] Length = 336 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -1 Query: 145 LPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 LP ++FDEGY+ LFGDDNL I +DGKTVHLSLD++TG+GFVSQDLYLH Sbjct: 31 LPVISFDEGYTQLFGDDNLAIHRDGKTVHLSLDERTGSGFVSQDLYLH 78 >ref|XP_006469297.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28-like [Citrus sinensis] Length = 334 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP + FDEGYSHLFG DNL++ +DGK+VHLSLD++TG+GFVS DLYLH Sbjct: 26 NLPIVPFDEGYSHLFGHDNLVVHRDGKSVHLSLDERTGSGFVSHDLYLH 74 >ref|XP_006448095.1| hypothetical protein CICLE_v10015872mg [Citrus clementina] gi|557550706|gb|ESR61335.1| hypothetical protein CICLE_v10015872mg [Citrus clementina] Length = 334 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP + FDEGYSHLFG DNL++ +DGK+VHLSLD++TG+GFVS DLYLH Sbjct: 26 NLPIVPFDEGYSHLFGHDNLVVHRDGKSVHLSLDERTGSGFVSHDLYLH 74 >gb|ACD03234.1| xyloglucan endotransglucosylase/hydrolase 10 [Malus domestica] Length = 336 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -1 Query: 145 LPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 LP + FDEGY+ LFGDDNL+IL+DGK+VHLSLD++TG+GFVSQDLY H Sbjct: 29 LPIIPFDEGYTKLFGDDNLMILRDGKSVHLSLDERTGSGFVSQDLYQH 76 >ref|XP_007153190.1| hypothetical protein PHAVU_003G014400g [Phaseolus vulgaris] gi|561026544|gb|ESW25184.1| hypothetical protein PHAVU_003G014400g [Phaseolus vulgaris] Length = 338 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/49 (71%), Positives = 45/49 (91%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP +AF++GY+HLFGD NL+I +DGK+VHLSLD++TG+GFVS DLYLH Sbjct: 30 NLPIIAFEDGYTHLFGDHNLVIHRDGKSVHLSLDERTGSGFVSHDLYLH 78 >gb|AGZ15408.1| xyloglucan endotransglucosylase/hydrolase protein 28 [Phaseolus vulgaris] Length = 327 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/49 (71%), Positives = 45/49 (91%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP +AF++GY+HLFGD NL+I +DGK+VHLSLD++TG+GFVS DLYLH Sbjct: 19 NLPIIAFEDGYTHLFGDHNLVIHRDGKSVHLSLDERTGSGFVSHDLYLH 67 >gb|AGV54504.1| xyloglucan endotransglucosylase/hydrolase protein 28-like protein [Phaseolus vulgaris] Length = 327 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/49 (71%), Positives = 45/49 (91%) Frame = -1 Query: 148 NLPNLAFDEGYSHLFGDDNLLILKDGKTVHLSLDQKTGAGFVSQDLYLH 2 NLP +AF++GY+HLFGD NL+I +DGK+VHLSLD++TG+GFVS DLYLH Sbjct: 19 NLPIIAFEDGYTHLFGDHNLVIHRDGKSVHLSLDERTGSGFVSHDLYLH 67