BLASTX nr result
ID: Akebia25_contig00013789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00013789 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214419.1| hypothetical protein PRUPE_ppa026042mg [Prun... 68 1e-09 gb|EXB36074.1| Calcium-activated outward-rectifying potassium ch... 59 7e-07 ref|XP_006474903.1| PREDICTED: two-pore potassium channel 1-like... 55 8e-06 >ref|XP_007214419.1| hypothetical protein PRUPE_ppa026042mg [Prunus persica] gi|462410284|gb|EMJ15618.1| hypothetical protein PRUPE_ppa026042mg [Prunus persica] Length = 354 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = +2 Query: 32 DAKVPLLSGLLDPSPQSNQKNTIKRRRFRRCRSAPI-EFIPLEKKNDVLPPPTESIFAKL 208 D + P++S L DPSPQ+NQKN +K R +RRC+SAP+ E++PL+ + P TESI L Sbjct: 5 DVREPMISALGDPSPQTNQKNPMKSRTYRRCKSAPLAEYVPLKTTDTGSVPVTESILQNL 64 Query: 209 NPSFTR 226 P+F + Sbjct: 65 RPNFQK 70 >gb|EXB36074.1| Calcium-activated outward-rectifying potassium channel 1 [Morus notabilis] Length = 355 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Frame = +2 Query: 32 DAKVPLLSGLLDPSPQSNQKNTIKRRRFRRCRSAPI-EFIPLEKKNDVLPPPTESIFAKL 208 D + PLLSG D +PQ+ K+T KR+RFRR +SAP+ +F+P EK + P + +IF + Sbjct: 5 DVRQPLLSGRTDLNPQTRSKDTPKRKRFRRSKSAPLADFVPFEKTSIGSDPQSNAIFGNI 64 Query: 209 NPSFTR 226 +P+ + Sbjct: 65 HPNICK 70 >ref|XP_006474903.1| PREDICTED: two-pore potassium channel 1-like isoform X1 [Citrus sinensis] gi|568841922|ref|XP_006474904.1| PREDICTED: two-pore potassium channel 1-like isoform X2 [Citrus sinensis] gi|568841924|ref|XP_006474905.1| PREDICTED: two-pore potassium channel 1-like isoform X3 [Citrus sinensis] gi|568841926|ref|XP_006474906.1| PREDICTED: two-pore potassium channel 1-like isoform X4 [Citrus sinensis] Length = 354 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 3/71 (4%) Frame = +2 Query: 23 NNGDAKVPLLSGLLDPSPQSNQKNTIKRRRFRRCRSAP---IEFIPLEKKNDVLPPPTES 193 +NG A PLLSG +D +PQ+N K+ KRRR RRCRSAP + + + +K+ +ES Sbjct: 3 SNG-ANQPLLSGFVDSTPQTNNKDAPKRRRLRRCRSAPQTDVAALDINEKDST--HLSES 59 Query: 194 IFAKLNPSFTR 226 +F K P+F R Sbjct: 60 LFGKPRPNFKR 70