BLASTX nr result
ID: Akebia25_contig00013764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00013764 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78981.1| hypothetical protein (mitochondrion) [Vicia faba] 60 3e-18 emb|CBI23680.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_003610975.1| Phosphatidylinositol 4-kinase type 2-beta [M... 55 7e-10 ref|XP_006380079.1| hypothetical protein POPTR_0008s21690g, part... 63 5e-08 emb|CBI23503.3| unnamed protein product [Vitis vinifera] 56 5e-06 >gb|AGC78981.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 120 Score = 59.7 bits (143), Expect(2) = 3e-18 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +3 Query: 102 HFSFALDSIGTKQRRRLNGER*GTRAVLLGAKAAGSG 212 HF FALD IGTKQRRR NGER TRAVLLGAKAAGSG Sbjct: 27 HFCFALDYIGTKQRRRRNGER--TRAVLLGAKAAGSG 61 Score = 57.8 bits (138), Expect(2) = 3e-18 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 25 LNPIHKPGNETKFVPFRQVGKVGIRT 102 +NPIHKPGNETKFVPFRQVGKVGIRT Sbjct: 1 MNPIHKPGNETKFVPFRQVGKVGIRT 26 >emb|CBI23680.3| unnamed protein product [Vitis vinifera] Length = 107 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +3 Query: 93 HTNHFSFALDSIGTKQRRRLNGER*GTRAVLLGAKAAGS 209 HTN FSFALDSIGTKQRRR NGER GTRAVLLG KAAGS Sbjct: 9 HTNQFSFALDSIGTKQRRRRNGERKGTRAVLLGTKAAGS 47 >ref|XP_003610975.1| Phosphatidylinositol 4-kinase type 2-beta [Medicago truncatula] gi|355512310|gb|AES93933.1| Phosphatidylinositol 4-kinase type 2-beta [Medicago truncatula] Length = 725 Score = 55.5 bits (132), Expect(2) = 7e-10 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = +3 Query: 102 HFSFALDSIGTKQRRRLNGER*GTRAVLLGAKAAGSG 212 HFSFAL IGTK RRR NGER TRAVLLGAKAAGSG Sbjct: 636 HFSFALYYIGTKLRRRRNGER--TRAVLLGAKAAGSG 670 Score = 33.5 bits (75), Expect(2) = 7e-10 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 55 TKFVPFRQVGKVGIRT 102 ++FVPFRQVGKVGIRT Sbjct: 620 SRFVPFRQVGKVGIRT 635 >ref|XP_006380079.1| hypothetical protein POPTR_0008s21690g, partial [Populus trichocarpa] gi|550333600|gb|ERP57876.1| hypothetical protein POPTR_0008s21690g, partial [Populus trichocarpa] Length = 207 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 99 NHFSFALDSIGTKQRRRLNGER*GTRAVLLGAKAAGSG 212 NHF FAL+SIGT QR+R NGER G RAVLLGAKAAGSG Sbjct: 1 NHFCFALNSIGTMQRKRRNGERKGVRAVLLGAKAAGSG 38 >emb|CBI23503.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 56.2 bits (134), Expect = 5e-06 Identities = 34/63 (53%), Positives = 35/63 (55%) Frame = -3 Query: 208 EPAAFAPSKTALVPYLSPFSLLLCFVPIESKAKLKWFVCLLYLLDERERTLFRFRVYGLD 29 E AAFAPSKTALVP+LSPF LLLCF FRFRVYGLD Sbjct: 113 ELAAFAPSKTALVPFLSPFRLLLCF--------------------------FRFRVYGLD 146 Query: 28 SVS 20 SVS Sbjct: 147 SVS 149