BLASTX nr result
ID: Akebia25_contig00013754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00013754 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79197.1| hypothetical protein VITISV_000240 [Vitis vinifera] 58 1e-06 >emb|CAN79197.1| hypothetical protein VITISV_000240 [Vitis vinifera] Length = 117 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/63 (47%), Positives = 40/63 (63%) Frame = -1 Query: 268 VDVHFLREKVRSGALETVFVSSSD*LADMLTKSISPSITNSHFVKLSLSDIFVPT*GGVL 89 VD HF+REK+ SG + T FV+S+D LAD+ TKS+ + KL D++ P GGVL Sbjct: 53 VDCHFIREKIASGYVATSFVNSNDQLADIFTKSLRGPRIKYIYNKLGAYDVYAPAWGGVL 112 Query: 88 RIM 80 IM Sbjct: 113 NIM 115