BLASTX nr result
ID: Akebia25_contig00013382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00013382 (490 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359120.1| PREDICTED: UTP--glucose-1-phosphate uridylyl... 57 3e-06 gb|EYU38932.1| hypothetical protein MIMGU_mgv1a005703mg [Mimulus... 56 5e-06 gb|EYU38931.1| hypothetical protein MIMGU_mgv1a005703mg [Mimulus... 56 5e-06 ref|XP_004503091.1| PREDICTED: UTP--glucose-1-phosphate uridylyl... 56 5e-06 ref|XP_006481963.1| PREDICTED: UTP--glucose-1-phosphate uridylyl... 56 6e-06 ref|XP_006430411.1| hypothetical protein CICLE_v10011657mg [Citr... 56 6e-06 gb|ACF04278.1| UTP-glucose 1 phosphate uridylyltransferase [Euca... 56 6e-06 ref|XP_006430412.1| hypothetical protein CICLE_v10011657mg [Citr... 55 8e-06 >ref|XP_006359120.1| PREDICTED: UTP--glucose-1-phosphate uridylyltransferase-like [Solanum tuberosum] Length = 607 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 470 VNSFLSYFKSIPSIIELNSLKVTGNVWFNTSITIKELVS 354 V+ F S FKSIPSIIEL+SLKVTG+VWF T IT+K VS Sbjct: 535 VDDFRSLFKSIPSIIELDSLKVTGDVWFGTGITLKGKVS 573 >gb|EYU38932.1| hypothetical protein MIMGU_mgv1a005703mg [Mimulus guttatus] Length = 471 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 470 VNSFLSYFKSIPSIIELNSLKVTGNVWFNTSITIKELVS 354 V SFLS FKSIPSII+L+SLKVTG+VWF SIT+K V+ Sbjct: 405 VASFLSRFKSIPSIIDLDSLKVTGDVWFGASITLKGKVT 443 >gb|EYU38931.1| hypothetical protein MIMGU_mgv1a005703mg [Mimulus guttatus] Length = 474 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 470 VNSFLSYFKSIPSIIELNSLKVTGNVWFNTSITIKELVS 354 V SFLS FKSIPSII+L+SLKVTG+VWF SIT+K V+ Sbjct: 408 VASFLSRFKSIPSIIDLDSLKVTGDVWFGASITLKGKVT 446 >ref|XP_004503091.1| PREDICTED: UTP--glucose-1-phosphate uridylyltransferase-like [Cicer arietinum] Length = 475 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 470 VNSFLSYFKSIPSIIELNSLKVTGNVWFNTSITIKELVS 354 V++FLS FKSIPSI+EL+SLKVTG+VWF +T+K VS Sbjct: 409 VSNFLSRFKSIPSIVELDSLKVTGDVWFGAGVTLKGKVS 447 >ref|XP_006481963.1| PREDICTED: UTP--glucose-1-phosphate uridylyltransferase-like [Citrus sinensis] Length = 469 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 470 VNSFLSYFKSIPSIIELNSLKVTGNVWFNTSITIKELVS 354 V +FLS FKSIPSIIEL+SLKVTG+VWF +IT+K V+ Sbjct: 403 VGNFLSRFKSIPSIIELDSLKVTGDVWFGANITLKGKVT 441 >ref|XP_006430411.1| hypothetical protein CICLE_v10011657mg [Citrus clementina] gi|557532468|gb|ESR43651.1| hypothetical protein CICLE_v10011657mg [Citrus clementina] Length = 469 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 470 VNSFLSYFKSIPSIIELNSLKVTGNVWFNTSITIKELVS 354 V +FLS FKSIPSIIEL+SLKVTG+VWF +IT+K V+ Sbjct: 403 VGNFLSRFKSIPSIIELDSLKVTGDVWFGANITLKGKVT 441 >gb|ACF04278.1| UTP-glucose 1 phosphate uridylyltransferase [Eucalyptus grandis] Length = 476 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 470 VNSFLSYFKSIPSIIELNSLKVTGNVWFNTSITIKELVS 354 V +FLS FKSIPSIIEL+SLKV+G+VWF T IT+K V+ Sbjct: 410 VGNFLSRFKSIPSIIELDSLKVSGDVWFGTGITLKGKVT 448 >ref|XP_006430412.1| hypothetical protein CICLE_v10011657mg [Citrus clementina] gi|557532469|gb|ESR43652.1| hypothetical protein CICLE_v10011657mg [Citrus clementina] Length = 441 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 470 VNSFLSYFKSIPSIIELNSLKVTGNVWFNTSITIK 366 V +FLS FKSIPSIIEL+SLKVTG+VWF +IT+K Sbjct: 403 VGNFLSRFKSIPSIIELDSLKVTGDVWFGANITLK 437