BLASTX nr result
ID: Akebia25_contig00013214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00013214 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56433.1| GTP-binding protein ERG [Morus notabilis] 55 8e-06 >gb|EXB56433.1| GTP-binding protein ERG [Morus notabilis] Length = 465 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/48 (50%), Positives = 31/48 (64%) Frame = +3 Query: 24 DTPVFDSSHYTLHTIDSDSATKSQQKPTWNKAYRAKADRIIFGNNSQK 167 D+ VFDSSHY + AT ++PTW+K YRAKAD +IFG +K Sbjct: 56 DSSVFDSSHYAMPGFFGSDATAPPKQPTWDKQYRAKADEVIFGKKKKK 103