BLASTX nr result
ID: Akebia25_contig00013027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00013027 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492274.1| PREDICTED: peptide transporter PTR2-like [Ci... 75 9e-12 ref|XP_006448044.1| hypothetical protein CICLE_v10014643mg [Citr... 75 9e-12 gb|EPS63244.1| hypothetical protein M569_11542, partial [Genlise... 74 3e-11 ref|XP_004297798.1| PREDICTED: peptide transporter PTR2-like [Fr... 73 5e-11 ref|XP_007222295.1| hypothetical protein PRUPE_ppa003339mg [Prun... 73 5e-11 gb|EXC05013.1| Peptide transporter [Morus notabilis] 72 6e-11 ref|XP_002315835.1| Peptide transporter PTR2-B family protein [P... 72 1e-10 gb|ABK94624.1| unknown [Populus trichocarpa] 72 1e-10 gb|ABR32183.1| peptide transporter [Hakea actites] 72 1e-10 gb|EYU30228.1| hypothetical protein MIMGU_mgv1a003438mg [Mimulus... 71 2e-10 ref|XP_007045395.1| Peptide transporter 2 isoform 1 [Theobroma c... 70 2e-10 gb|AAF20002.1|AF213936_1 amino acid/peptide transporter [Prunus ... 70 2e-10 gb|EXC24398.1| Peptide transporter [Morus notabilis] 70 3e-10 emb|CBI26754.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002285274.1| PREDICTED: peptide transporter PTR2-like [Vi... 70 3e-10 emb|CAN80199.1| hypothetical protein VITISV_030909 [Vitis vinifera] 70 3e-10 ref|XP_004504618.1| PREDICTED: peptide transporter PTR2-like [Ci... 69 7e-10 ref|XP_004504617.1| PREDICTED: peptide transporter PTR2-like [Ci... 69 7e-10 gb|EXC05011.1| Peptide transporter [Morus notabilis] 69 9e-10 ref|XP_002521890.1| peptide transporter, putative [Ricinus commu... 69 9e-10 >ref|XP_006492274.1| PREDICTED: peptide transporter PTR2-like [Citrus sinensis] Length = 584 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI+GKPVLKQNTGNWRACPFILGTEC Sbjct: 24 YTGDGSVDISGKPVLKQNTGNWRACPFILGTEC 56 >ref|XP_006448044.1| hypothetical protein CICLE_v10014643mg [Citrus clementina] gi|557550655|gb|ESR61284.1| hypothetical protein CICLE_v10014643mg [Citrus clementina] Length = 607 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI+GKPVLKQNTGNWRACPFILGTEC Sbjct: 47 YTGDGSVDISGKPVLKQNTGNWRACPFILGTEC 79 >gb|EPS63244.1| hypothetical protein M569_11542, partial [Genlisea aurea] Length = 552 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDING PVLK+NTGNWRACPFILGTEC Sbjct: 23 YTGDGSVDINGNPVLKRNTGNWRACPFILGTEC 55 >ref|XP_004297798.1| PREDICTED: peptide transporter PTR2-like [Fragaria vesca subsp. vesca] Length = 584 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI G PVLKQNTGNWRACPFILGTEC Sbjct: 24 YTGDGSVDIEGNPVLKQNTGNWRACPFILGTEC 56 >ref|XP_007222295.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica] gi|462419231|gb|EMJ23494.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica] Length = 584 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI GKPVLKQ+TGNWRACPFILGTEC Sbjct: 24 YTGDGSVDITGKPVLKQSTGNWRACPFILGTEC 56 >gb|EXC05013.1| Peptide transporter [Morus notabilis] Length = 1129 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI+GKPVLK+NTGNW+ACPFILGTEC Sbjct: 569 YTGDGSVDIHGKPVLKRNTGNWKACPFILGTEC 601 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDINGKPVLKQNTGNW+AC FILGTEC Sbjct: 14 YTGDGSVDINGKPVLKQNTGNWKACYFILGTEC 46 >ref|XP_002315835.1| Peptide transporter PTR2-B family protein [Populus trichocarpa] gi|222864875|gb|EEF02006.1| Peptide transporter PTR2-B family protein [Populus trichocarpa] Length = 584 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDING PVLKQ TGNW+ACPFILGTEC Sbjct: 25 YTGDGSVDINGNPVLKQKTGNWKACPFILGTEC 57 >gb|ABK94624.1| unknown [Populus trichocarpa] Length = 133 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDING PVLKQ TGNW+ACPFILGTEC Sbjct: 25 YTGDGSVDINGNPVLKQKTGNWKACPFILGTEC 57 >gb|ABR32183.1| peptide transporter [Hakea actites] Length = 583 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI+GKPVLK+NTG WRACPFILGTEC Sbjct: 23 YTGDGSVDIDGKPVLKENTGKWRACPFILGTEC 55 >gb|EYU30228.1| hypothetical protein MIMGU_mgv1a003438mg [Mimulus guttatus] Length = 585 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI G PVLK NTGNWRACPFILGTEC Sbjct: 25 YTGDGSVDIKGNPVLKSNTGNWRACPFILGTEC 57 >ref|XP_007045395.1| Peptide transporter 2 isoform 1 [Theobroma cacao] gi|508709330|gb|EOY01227.1| Peptide transporter 2 isoform 1 [Theobroma cacao] Length = 584 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVD +GKPVLKQNTGNW+ACPFILG EC Sbjct: 24 YTGDGSVDFDGKPVLKQNTGNWKACPFILGNEC 56 >gb|AAF20002.1|AF213936_1 amino acid/peptide transporter [Prunus dulcis] Length = 559 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI GKPVLKQ+TGNW ACPFILGTEC Sbjct: 24 YTGDGSVDITGKPVLKQSTGNWXACPFILGTEC 56 >gb|EXC24398.1| Peptide transporter [Morus notabilis] Length = 561 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI GKPVLKQNTGNW+AC FILGTEC Sbjct: 24 YTGDGSVDIQGKPVLKQNTGNWKACVFILGTEC 56 >emb|CBI26754.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 +TGDGSVDI+GKPVL+ NTGNWRACPFILGTEC Sbjct: 26 HTGDGSVDIHGKPVLRSNTGNWRACPFILGTEC 58 >ref|XP_002285274.1| PREDICTED: peptide transporter PTR2-like [Vitis vinifera] Length = 586 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 +TGDGSVDI+GKPVL+ NTGNWRACPFILGTEC Sbjct: 26 HTGDGSVDIHGKPVLRSNTGNWRACPFILGTEC 58 >emb|CAN80199.1| hypothetical protein VITISV_030909 [Vitis vinifera] Length = 551 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 +TGDGSVDI+GKPVL+ NTGNWRACPFILGTEC Sbjct: 26 HTGDGSVDIHGKPVLRSNTGNWRACPFILGTEC 58 >ref|XP_004504618.1| PREDICTED: peptide transporter PTR2-like [Cicer arietinum] Length = 584 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVD G+PVLKQNTGNW+ACPFILG EC Sbjct: 24 YTGDGSVDFKGRPVLKQNTGNWKACPFILGNEC 56 >ref|XP_004504617.1| PREDICTED: peptide transporter PTR2-like [Cicer arietinum] Length = 586 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVD G+PVLKQNTGNW+ACPFILG EC Sbjct: 26 YTGDGSVDFKGRPVLKQNTGNWKACPFILGNEC 58 >gb|EXC05011.1| Peptide transporter [Morus notabilis] Length = 584 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVDI GKPVLK+NTGNW+AC FILGTEC Sbjct: 24 YTGDGSVDIQGKPVLKRNTGNWKACVFILGTEC 56 >ref|XP_002521890.1| peptide transporter, putative [Ricinus communis] gi|223538928|gb|EEF40526.1| peptide transporter, putative [Ricinus communis] Length = 585 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 111 YTGDGSVDINGKPVLKQNTGNWRACPFILGTEC 209 YTGDGSVD+ G PVLKQ TGNW+ACPFILGTEC Sbjct: 25 YTGDGSVDLKGNPVLKQKTGNWKACPFILGTEC 57