BLASTX nr result
ID: Akebia25_contig00012955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012955 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB34467.1| hypothetical protein L484_004857 [Morus notabilis] 58 1e-06 ref|XP_002320531.2| hypothetical protein POPTR_0014s16780g [Popu... 58 2e-06 ref|XP_006447832.1| hypothetical protein CICLE_v10014215mg [Citr... 56 5e-06 ref|XP_006447831.1| hypothetical protein CICLE_v10014215mg [Citr... 56 5e-06 >gb|EXB34467.1| hypothetical protein L484_004857 [Morus notabilis] Length = 651 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 141 GSSRVSIPNSARKTIQNIKEIAGNHSDDEIYA 236 G RVSIP+S RKTIQN+KEIAGNHSDDEIYA Sbjct: 4 GGFRVSIPSSVRKTIQNLKEIAGNHSDDEIYA 35 >ref|XP_002320531.2| hypothetical protein POPTR_0014s16780g [Populus trichocarpa] gi|550324360|gb|EEE98846.2| hypothetical protein POPTR_0014s16780g [Populus trichocarpa] Length = 886 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 141 GSSRVSIPNSARKTIQNIKEIAGNHSDDEIYA 236 G RVSIP++ARKTIQNIKEIAGNHSD+EIYA Sbjct: 4 GGVRVSIPSNARKTIQNIKEIAGNHSDEEIYA 35 >ref|XP_006447832.1| hypothetical protein CICLE_v10014215mg [Citrus clementina] gi|568830272|ref|XP_006469425.1| PREDICTED: hyphally regulated cell wall protein 3-like isoform X2 [Citrus sinensis] gi|557550443|gb|ESR61072.1| hypothetical protein CICLE_v10014215mg [Citrus clementina] Length = 886 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 129 ANMSGSSRVSIPNSARKTIQNIKEIAGNHSDDEIYA 236 ++ S SSRVSIPN+ +K IQNIKEI GNHS+DEIYA Sbjct: 8 SSSSSSSRVSIPNNMKKMIQNIKEITGNHSEDEIYA 43 >ref|XP_006447831.1| hypothetical protein CICLE_v10014215mg [Citrus clementina] gi|568830270|ref|XP_006469424.1| PREDICTED: hyphally regulated cell wall protein 3-like isoform X1 [Citrus sinensis] gi|557550442|gb|ESR61071.1| hypothetical protein CICLE_v10014215mg [Citrus clementina] Length = 887 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 129 ANMSGSSRVSIPNSARKTIQNIKEIAGNHSDDEIYA 236 ++ S SSRVSIPN+ +K IQNIKEI GNHS+DEIYA Sbjct: 8 SSSSSSSRVSIPNNMKKMIQNIKEITGNHSEDEIYA 43