BLASTX nr result
ID: Akebia25_contig00012783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012783 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007277855.1| hypothetical protein CGGC5_713 [Colletotrich... 60 3e-07 gb|EQB59445.1| hypothetical protein CGLO_00169 [Colletotrichum g... 60 4e-07 ref|XP_007599320.1| hypothetical protein CFIO01_01785 [Colletotr... 58 1e-06 gb|EHK27453.1| hypothetical protein TRIVIDRAFT_118255, partial [... 56 5e-06 >ref|XP_007277855.1| hypothetical protein CGGC5_713 [Colletotrichum gloeosporioides Nara gc5] gi|429858221|gb|ELA33047.1| hypothetical protein CGGC5_713 [Colletotrichum gloeosporioides Nara gc5] Length = 425 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 15 QLSITERRMHALSPYIAPLSFNVPPPSQQRNVIDQLTAKSV 137 ++ IT RRM AL PYIAPL+F+VPPP++ RN+ID+LT K V Sbjct: 228 EMDITARRMSALQPYIAPLTFDVPPPTKDRNIIDRLTEKQV 268 >gb|EQB59445.1| hypothetical protein CGLO_00169 [Colletotrichum gloeosporioides Cg-14] Length = 410 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +3 Query: 15 QLSITERRMHALSPYIAPLSFNVPPPSQQRNVIDQLTAKSV 137 ++ IT RRM AL PYIAPL+F+VPPP++ RN+ID+LT K + Sbjct: 211 EMDITARRMSALQPYIAPLTFDVPPPTKDRNIIDRLTEKQI 251 >ref|XP_007599320.1| hypothetical protein CFIO01_01785 [Colletotrichum fioriniae PJ7] gi|588895417|gb|EXF77138.1| hypothetical protein CFIO01_01785 [Colletotrichum fioriniae PJ7] Length = 377 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/41 (53%), Positives = 34/41 (82%) Frame = +3 Query: 15 QLSITERRMHALSPYIAPLSFNVPPPSQQRNVIDQLTAKSV 137 +LS+ +RRM L PY+APL+F VPPPS++RN++D++T K + Sbjct: 199 ELSLPDRRMRTLEPYVAPLTFEVPPPSKERNLVDRMTEKQI 239 >gb|EHK27453.1| hypothetical protein TRIVIDRAFT_118255, partial [Trichoderma virens Gv29-8] Length = 305 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +3 Query: 24 ITERRMHALSPYIAPLSFNVPPPSQQRNVIDQLTAKSV 137 I +R+M ++S IAPLSFNVPPPS+QRN+ID+L+AK V Sbjct: 138 IPDRQMQSISANIAPLSFNVPPPSEQRNIIDRLSAKQV 175